CaringBridgeTM
Guestbook
Thanks for visiting our guestbook!
(This is an open
guestbook. Please feel free to add an entry to the guestbook for others to read.)
**** IF YOU DON'T SEE YOUR ENTRY AFTER
ADDING -- PLEASE CLICK ON RELOAD/REFRESH ****
*** AOL Users: The AOL browser seems to have particular problems reloading after
this page is updated. Your Entry is probably already there - you are just not seeing
it. Close your screen completely and re-enter it.***
Click here to sign the guestbook.
Click here to return to the current guestbook.
Click here to go back to the main page.
HAPPY NEW YEAR
In Love & Prayer...Eleasha & Cody & Greg & Riley & Jeremy & Marina <ehilliard@verizon.net>
www.forcody.org, - Wednesday, December 31, 2003 11:48 PM CST
Just wanted to wish you a HEALTHY and HAPPY 2004! Have fun playing in the snow.....my children would be so jealous. We don't see much show down here in Alabama. :(
God bless,
Lisa Agee <lagee67@hotmail.com www.caringbridge.com/page/ross>
Camden, AL - Wednesday, December 31, 2003 7:47 PM CST
HELLO! Just wanted to say HI I am mom to Jason, an almost 4 year old with ALL Pre-b, standard risk, Dx: May 9, 2003. We are on week 32 of POG 9905. Happy almost 2004!
Jason's site!
Dawn <dnunley@comcast.net>
Aberdeen, Md - Wednesday, December 31, 2003 3:13 AM CST
Wishing you all a great holiday and a Happy and Healthy 2004.
Its wonderful to see you doing well Aidan!
Mom funny you mention that, Ronnie has really bad peely skin too... it seems to look worse than it bothers him
Chris ~ Gooch's Site ~
- Tuesday, December 23, 2003 6:19 AM CST
"Fear Not," said the angel, "For I bring you tidings of great joy. For unto you is born this day in Bethlehem - a Saviour who is Christ the Lord."
"And this shall be a sign unto you. You shall find the babe wrapped in swaddling clothes and lying in a manger."
MERRY CHRISTMAS!
In Love & Prayer...Eleasha & Cody <ehilliard@verizon.net>
www.forcody.org, - Tuesday, December 23, 2003 0:49 AM CST
Love everyone at Post Pals
vikki <viks@postpals.co.uk>
- Monday, December 22, 2003 3:06 PM CST
Jean - Quilts of Love <quiltsoflove@quiltsoflove.com>
- Sunday, December 21, 2003 12:37 AM CST
Looking forward to your visit the morning of the 24th.
Love. Dad
Dave Munro <munros@pacifier.com>
- Saturday, December 20, 2003 10:57 AM CST
Christmas Greetings to the Goodwin family!
I stopped by just to say hi and let you know
that I am thinking of you. Enjoy your holidays.
Lots of love....
The family of Jackson Espeseth
Clear Lake, Wisconsin - Friday, December 19, 2003 4:00 PM CST
I love the multiple choice quiz. Hope you have a great time in rainy Portland for Christmas. Maybe a miracle will happen and it will snow. Well just in case it doen't we are going to drive to the snow. Take care.
www.caringbridge.org/wa/mitchellboy
Paula (Mitch's mom) <PHSTYLN@msn.com>
Vancouver, w - Tuesday, December 16, 2003 8:22 AM CST
Just wanted to wish you all a great holiday and a Healthy and Happy New Year
(oh my gosh, you're first ones OFF TREATMENT!)
Aidan you're in our thoughts & prayers!!!!
Angel Chris ~ Smile Quilts ~
chrisrusso_@hotmail.com
- Sunday, December 14, 2003 3:44 PM CST
Well, I guess I am just not on the ball..... I missed your birthday!!!??? Hope you had a great one, my youngest will be turning 6 at the end of December, so I agree 5 is a terrific age. Loved the Christmas quiz, didn't know all of the answers so had to guess at some of em!! Now that was alot of work putting that together!! Wishing you a wonderful Christmas full of God's blessings, may it be your best ever!
Christy, Sean & Jackson <calee59@wi.rr.com>
South Milwaukee, WI - Sunday, December 14, 2003 2:45 PM CST
I gently wrap warm thoughts of you
in my christmas prayers
For Heaven to smile on you
For Angels to watch over you
and the love of Jesus to fill your heart
Have A Merry Christmas
God Bless You And Your Family This Holiday
Have a Marry Christmas and a Blessed New Year
Chris Ullrich - Grand-daughter dx with AML M5 <c_ullrich@msn.com, www.caringbridge.com/page/isabellaledesma>
Hemingford, Ne USA - Thursday, December 11, 2003 6:25 PM CST
I hope you don't have to wait that long evertime at Doernbechers. We sometimes wait for ever and sometimes just zip in and out. So it just depends. What Dr. does Aidan have there?? Well take care and I hope all is well.
www.caringbridge.org/wa/mitchellboy
Paula (Mitch's mom) <PHSTYLN@msn.com>
Vancouver, Wa - Tuesday, December 9, 2003 8:56 PM CST
Happy Birthday Wishes Aidan. Wow 5 Years Old. What a Fun Age. We hope that you had an awesome day.
The Anderson Family <tandha@amerytel.net>
Clayton, WI - Monday, December 8, 2003 11:00 PM CST
Hope you have a wonderful birthday and eat lots cake.
Kim
Hannah's page
<kymberleigh321@aol.com�>
TN - Sunday, December 7, 2003 9:34 PM CST
Happy Birthday Aidan! We hope you and your dad had a wonderful birthday party last week. Maybe another one today? Enjoy your day and eat lots of cake.
Smile Quilts Angel Sprite <sprite@tds.net>
Eckert, Colorado USA - Sunday, December 7, 2003 2:09 PM CST
Here's hoping you have a great day!
Love Angel Toto <pat_totoofoz@yahoo.com>
- Sunday, December 7, 2003 12:51 AM CST
Aidan, I'm so happy that your treatment is over. I enjoyed reading all the things your mom said in the journal. You have been thourgh quite alot for such a young fellow. Maybe someday we can come visit your family.
Jennifer Gwin <jenrog@adelphia.net>
Kelso, W USA - Sunday, December 7, 2003 0:12 AM CST
HAPPY BIRTHDAY AIDAN!!!
We're thinking of you and wishing you all the best!!!!!
Angel Chris {Goochs mom} ~ Smile Quilts ~
chrisrusso_@hotmail.com
- Saturday, December 6, 2003 3:23 PM CST
Happy Birthday to You!!!!
and many more!!!
Lynn <candlys@aol.com>
www.caringbridge.com/pa/jessiespage, PA - Saturday, December 6, 2003 10:30 AM CST
Hey Aidan,
Just popping in to wish you a very HAPPY BIRTHDAY!
Enjoy your special day!
Kathy Haws
1000 Oaks, CA - Friday, December 5, 2003 10:13 PM CST
I am starting my rounds early as I have many QOL children to visit, I just wanted to make sure you know we are all thinking of you and wishing you the best Christmas ever.
Love Angel Toto <pat_totoofoz@yahoo.com>
- Friday, December 5, 2003 10:28 AM CST
Hey Aidan! I want to wish you a WONDERFUL birthday! And congrats on finishing treatment! Way to go!!!!
Birthday hugs to you!
Laura Mahurin
Richfield, MN USA - Thursday, December 4, 2003 6:43 AM CST
What a blessing to hear Aidan's latest update! Sounds like you all had a great Thanksgiving! Party on!
Jill Nyhus
Falls Church, VA USA - Monday, December 1, 2003 12:37 AM CST
Love the picture on the front!!! Happy Holidays to you, Laura
www.caringbridge.org/ca/coltonmeyer <foryoucolton@aol.com >
- Thursday, November 27, 2003 11:51 AM CST
Your party sounds awesome!
Happy Thanksgiving to you all.
The family of Jackson Espeseth <eaglet@cltcomm.net>
- Wednesday, November 26, 2003 9:08 PM CST
Hope you have a great thanksgiving!
DeAnna and Chase caringbridge.org/ga/chasesmiracle/
- Wednesday, November 26, 2003 8:21 PM CST
Wishing you a warm, safe, wonderful Thanksging from across the miles!!!
Love Kellie <happythanksgiving@turkey.com>
- Wednesday, November 26, 2003 1:10 PM CST
I am sorry we weren't at Doernbecher's the same day too. That would be nice to meet up there.
Have a great Thanksgiving.
www.caringbridge.org/wa/mitchellboy
Paula (Mitch's mom) <PHSTYLN@msn.com>
vancouver, Wa - Wednesday, November 26, 2003 7:30 AM CST
Special Thanksgiving Wishes. I hope your day is filled with many Blessings.
The Anderson Family <tandha@amerytel.net>
Clayton, WI - Tuesday, November 25, 2003 2:17 PM CST
Happy Thanksgiving Aidan & family! You certainly have a lot to celebrate this year!
Christy <calee59@wi.rr.com>
S. Milwaukee, WI - Monday, November 24, 2003 10:53 PM CST
What a cool slide you guys!!! Wish we could have shared in the celebration with you!!!
Kellie <the temperature is falling.itsgoingtosnow soon@minnesota>
- Friday, November 21, 2003 9:55 AM CST
Aidan, I am glad to hear you are doing well.
We hope your family has a nice holiday and you continue feeling good & doing great buddy.
Angel Chris ~ Smile Quilts ~
chrisrusso_@hotmail.com
- Thursday, November 20, 2003 2:07 PM CST
Aidan,
Looks like you had a really cool party and a great time! You earned it Buddy! Take care of yourself and keep getting stronger......
Christy <calee59@wi.rr.com>
South Milwaukee, WI - Wednesday, November 19, 2003 8:18 PM CST
Hey Goodwins! Congratulations from the McDonaghs, we are so happy for you!
Laura McDonagh <mcdonaghmatt_laura@hotmail.com>
Nampa, ID USA - Tuesday, November 18, 2003 5:21 PM CST
Thanks for the update. Looking forward to seeing all of you next week. Don't forget the swim suits and the golf clubs!! Love
Dad and Mom
Dave Munro <munros@pacifier.com>
- Tuesday, November 18, 2003 2:24 PM CST
Just stopping by to say hello. Did you make it to Doernbecher's yet?? It is non-stop rain here, but no snow for us. Take care.
www.caringbridge.org/wa/mitchellboy
Paula (Mitch's mom) <PHSTYLN@msn.com>
Vancouver, Wa - Sunday, November 16, 2003 3:25 PM CST
Hey guys glad to hear things are going well for you. I was like that too, I wanted to stash the 6mp, I didnt want to flush anything! I dont think its real to the kids til the port comes out though...
Chris ~ Gooch's Site ~
- Friday, November 14, 2003 9:58 AM CST
Thanks for sharing your page - found it at squirel tales. I was just told one week ago today that my daughter may have lukemia. I won't know for one week yet. I'm sure you know that awful waiting period. It's encouraging to read the remission stories. Her page is www.caringbridge.org/pa/kianna
Sharon <kianna6@comcast.net>
pa - Wednesday, November 12, 2003 9:55 AM CST
Dear Goodwin Family-
We sure wish we lived closer to join your wonderful celebration today. We hope that it is a great time. We will continue to keep you all in prayer. We are so happy for your family and little Aidan. He has a big birthday coming up too.
P.S. I Love The Song Mike wrote :)
Take Care.
Have a Great Day Today.
Love,
The Anderson Family <tandha@amerytel.net>
Clayton, WI - Sunday, November 9, 2003 9:36 AM CST
It's interesting to read how different children react at the end of treatment. I agree with you: I think our children, the ones that were treated AND not, will be awesome, compassionate adults.
God bless,
Lisa Agee <lagee67@hotmail.com www.caringbridge.com/page/ross>
Camden, AL - Saturday, November 8, 2003 9:52 AM CST
Dear Goodwin family,
Hope you have a crazy, wonderful week full of laughs and love!!
Christy <calee59@wi.rr.com>
S. Milwaukee, WI - Saturday, November 8, 2003 1:22 AM CST
Most interesting transition. We are excited about seeing all of you this weekend. Doesn't sound like you will get much rest this week but we will help as much as we can when we get there Friday. Love.
Dad and Mom
Dave Munro <munros@pacifier.com>
- Tuesday, November 4, 2003 1:28 PM CST
HAPPY HALLOWEEN!!!!
Kellie <Kellie@trickrtreat.smellmyfeetgivemesomethinggoodtoeat>
- Friday, October 31, 2003 10:44 AM CST
Hooray Aidan!!! Congrats on the last of your chemo!!!! Have a great day!!! Love and Hugs!
Vicky ~ Quilts of Love <vickynelson@msn.com>
Gilbert, AZ - Friday, October 31, 2003 9:36 AM CST
Hooray!!! Hooray!!! I was thinking of you all on Sunday realizing it was Aidan's last day of chemo, etc.! It just took me until today to get on here and say congratulations. What an amazing road you have been down and what amazing boys you have. I hope you adjust quickly to a new normal! Many prayers have been said for your little guy. I'm glad you all made it through this together! Thank you for sharing your journey through this site it's been nice to check up on you all.
Cathy Coleman <kitcat2068@hotmail.com>
Silverdale, WA 98383 - Friday, October 31, 2003 0:14 AM CST
Dear Elizabeth and Aidan...
Welcome to life after chemotherpy...it will be interesting to learn what you think of it here...approaching our second month without drugs, doctors and hospitals as a regular part of our lives and I continue to acclimate to this "other side". It takes time, and it's important to allow yourself to take all the neccesssary steps towards your comfort zone.
Anyway, congratualtions to you on this amazing milestone!!! WOW!!! I know how difficult it was to finally reach it, my hats off to you.
God Bless you and yours as this journey continues...another path awaits us!!!
Hugs from across the miles.
Love Kellie <kellie@minnesota.brrr..it'sgetting coldhere>
- Wednesday, October 29, 2003 3:53 PM CST
You have a birthday coming up, so have a happy one. congradulations on being done with treatment. Have a happy Halloween.
www.caringbridge.org/wa/mitchellboy
Paula (Mitch's mom) <PHSTYLN@msn.com>
Vancouver, Wa - Tuesday, October 28, 2003 9:40 PM CST
Doing the happy dance for you here in Alabama!! I wish I could be there with you when you celebrate ~ I'll be thinking about you!
God bless,
Lisa Agee <lagee67@hotmail.com "www.caringbridge.com/page/ross">
Camden, AL - Tuesday, October 28, 2003 12:34 AM CST
Never signed before, but Congratulations!!! God Bless you :) In His Strong Love,
Cassandra <cmraven@msn.com>
Albuquerque, NM - Monday, October 27, 2003 9:55 PM CST
Make a joyful noise unto the Lord!! What great news, congratulations to you all for making it through this tremendous trial. God bless you all and have a wonderful celebration!!
PS Aidan YOU are my hero!
Christy <calee59@wi.rr.com>
S. Milwaukee, WI - Monday, October 27, 2003 9:17 PM CST
This is such wonderful news for you..Can't begin to tell you how happy I am for Aidan and for you..Hugs Carolyn
{Quilts of Love}
Carolyn <carolynj52@ilovejesus.net>
- Monday, October 27, 2003 1:22 AM CST
Elisabeth-
Oh my gosh!!! No more steroids - what a great thing! What a nice feeling to be in the last week of treatment - for all of you. A big congratulations to Aidan - enjoy off treatment life- Mitch is almost there himself - 4 1/2 months to go!!! Thank you for always leaving such nice messages in Mitchell's guestbook.
Diane Mathis (Mitchell's mom) <Stubby3620@aol.com>
Boynton Beach, FL - Sunday, October 26, 2003 5:38 PM CST
Hi Aidan, Hope you have a funny Halloween. Sending lots of hugs and prayers your way.
center>
Joan Lewellen <jlewellen@centurytel.net>
Little Rock, AR - Thursday, October 23, 2003 11:49 PM CDT
YIPPEEEE is right. I hope dog is still healthy. Wow, the light at the end of the tunnel is getting really bright. We can't wait to see you in a couple of weeks. Love.
Dad and Mom
Dave Munro <munros@pacifier.com>
- Thursday, October 23, 2003 10:44 PM CDT
That is great news!!! I say "YIPEE" along w/Aidan!! God is good!
Christy <calee59@wi.rr.com>
South Milwaukee, WI - Thursday, October 23, 2003 2:09 PM CDT
I stopped by to check on Aidan and the family. I am SO happy to read about the last finger poke. I don't like them either. :) I will be back again soon. Wishing you happy days ahead. Lots of love.
Michelle E. <eaglet@cltcomm.net>
Clear Lake, WI - Tuesday, October 21, 2003 9:01 PM CDT
No more pokes. Yipee. I know I will feel uncertain when my son is done with treatment also, it is scary to say the least. But also how wonderful not to have to go get poked anymore. I know Mitch can't wait until he's done. We are half way through. (6 months to go)
Paula (Mitch's mom) <www.caringbridge.org/wa/mitchellboy>
Vancouver, Wa - Monday, October 20, 2003 8:30 AM CDT
Praying that you will survive the last round of steroids w/flying colors. WooHoo!!!!! Way to go Aidan!
Christy
S. Milwaukee, WI - Saturday, October 18, 2003 10:40 AM CDT
Seeing those numbers make you wonder how we've done it all. Funny what normal becomes, isn't it! I'm so glad you are nearing the end of treatment. YAHOO! Keeping you in my thoughts and prayers ~
Lisa Agee <www.caringbridge.com/page/ross>
Camden, AL - Thursday, October 16, 2003 9:17 AM CDT
Hi Aidan...Angel Carolyn here from your Quilts of Love family wishing you a fun Halloween...Hugs
Carolyn <carolynj52@ilovejesus.net>
Oklahoma United States - Wednesday, October 15, 2003 12:33 AM CDT
When you put it all in writing like that, you can see what an awful toll this disease takes on families. I guess the list doesn't even begin to convey the physical and emotional turmoil you've all undergone since Aidan's diagnosis. I admire the grace that you've displayed and my thoughts and prayers will be with you all as you count down the days. May you continue to count on our Lord for your every need. God bless the Goodwin family.
Christy
South Milwaukee, WI - Tuesday, October 14, 2003 9:23 AM CDT
Hugs,
Island Princess
Island Princess <islandprincess@quiltsoflove.com>
- Monday, October 13, 2003 4:11 PM CDT
so happy for you and your family
lots of love and prayers-you look so good;love Betsy and Jack
javk and betsy caldwell <jbcald@aol.com>
Des Moines, WA usa - Monday, October 13, 2003 2:58 PM CDT
Weekly check in time! Hope all is well with the Goodwin family and that you are enjoying your fall. Will check in again soon, until then God Bless you all.
Christy
S. Milwaukee, WI - Friday, October 10, 2003 4:31 PM CDT
center>
Aidan
So glad I found your site! I will come back and visit often to see how you're doing. Looks like you play soccer.
So did both my boys...but that was a long time ago. They're all grown up now...but they sure had fun!
Have a great weekend! I'll be back soon.
Blessings,
Debi
RAOK and HOS
Debi Blacklidge <amhardy1@cox.net>
Southern California, CA United States - Friday, October 10, 2003 12:14 AM CDT
Wishing you all the best and a Happy & HEALTHY Halloween from everyone at Smile Quilts
Angel Chris and all your friends at ~ Smile Quilts ~
chrisrusso_@hotmail.com
- Wednesday, October 8, 2003 8:18 AM CDT
Hello Aidan, Just wanted to say hello and say I am thinking of you...Hugs, Becky
Becky <beckybrown_1976@yahoo.com>
Pineville, WV USA - Monday, October 6, 2003 1:05 PM CDT
Just stopping by to check in and see how things are going in WA...you all remain in our thoughts and prayers...
In Love & Prayer...Eleasha & Cody <www.forcody.org>
- Sunday, October 5, 2003 6:17 PM CDT
Your lives sound so full and so NORMAL....know you are counting the days till Aidan's treatment is completed. I love visiting your site, it is encouraging & uplifting. You have 2 amazing little boys there! Not to mention a pretty amazing mom & dad too! God Bless!
Christy
South Milwaukee, WI - Friday, October 3, 2003 9:00 AM CDT
Cant wait until you guys are off treatment too! Start singing the no more chemo song, its coming up fast!
Chris ~ Gooch's Site ~
- Wednesday, October 1, 2003 9:43 AM CDT
Just wanted to stop by again and check to see how you are doing. Hope the emotions get better for you. I know that I get all worked up over stuff but I am not even on steriods! You are in good hands! Thinking of you.
Christine
Tacoma, WA - Tuesday, September 30, 2003 5:53 PM CDT
Hey Goodwin family, just dropping in to see how things are going. Hope the last couple of weeks have been better for Aidan and all of you. Will check in again soon, until then, keeping you all in my prayers.
Christy
South Milwaukee, wi - Tuesday, September 30, 2003 9:19 AM CDT
Hello Goodwin Family,
We just wanted to let you know that we are thinking of you. It sounds like you have been very busy. Happy to see that Mom & Dad got to spend some time away.
Take Care.
The Anderson Family <tandha@amerytel.net>
Clayton, WI - Monday, September 29, 2003 9:56 PM CDT
Hi Aidan! Stopping by to say...
Lots of Love!!!
Cameron's Page
~Angel~Sheri
- Friday, September 26, 2003 9:38 AM CDT
Poor baby, it must be so tough not knowing why you feel so upset about everything, tough on you too Mom. Will be praying that things even out some for Aidan and for an extra does of patience and endurance for you too. Take care of yourselves and God bless....
Christy
South Milwaukee, WI - Monday, September 22, 2003 10:41 AM CDT
Love Angel Toto
- Sunday, September 21, 2003 2:18 AM CDT
Hi Aidan and Family,
Hey Aiden, I sure hope you are enjoying pre-school! You are getting so big! Loved the pictures! Leaving you lots of Hugs & Love~
Jean - Quilts of Love <jean@quiltsoflove.com>
- Wednesday, September 17, 2003 11:26 AM CDT
Hi Goodwin family,
Just wanted to drop in and see if anything new is going on. Hope Mom and Dad enjoyed their time away. I know Aidan is going to be ending his maintenance treatment soon. Hope he will sail thru what's left of it with flying colors and that he will remain healthy & strong. Is Andrew still liking school? My two boys seem to like it pretty well except when they have to get up in the morning!! Will check back on you later, you all remain in our prayers.....
Christy, Sean & Jackson
South Milwaukee, WI - Wednesday, September 17, 2003 9:27 AM CDT
Stopping by with hugs Aidan.
Angel Hugs,
Island Princess
Island Princess <islandprincess@quiltsoflove.com>
- Wednesday, September 17, 2003 0:01 AM CDT
So HAPPY chemo is almost done! Go Aiden!
www.caringbridge.org/mn/marisa
Marisa, liver transplant <sisterpiranha@yahoo.com>
SSP, MN - Tuesday, September 16, 2003 9:28 PM CDT
It is good to see Aidan doing so good. I am praying for you all and know that you are in good hands. God Bless you all! PS: I heard you had a great little time away, just what the doctor order! :)
Cousin Sara B.
Corvallis, OR - Monday, September 15, 2003 10:17 PM CDT
What are you down to, the 6 week mark now? I am still adjusting to this no more chemo myself. Wishing you all the best,
Chris ~ Gooch's Site ~
- Monday, September 15, 2003 7:34 AM CDT
Aidan,
Hope you are having a good week. Are you feeling better now? Just wanted to drop in & check on you.... take care.
Christy, Sean & Jackson
South Milwaukee, WI - Friday, September 5, 2003 9:09 AM CDT
I was so thrilled to read that Aidan's spinal fluid was clear! That is such an answer to prayer. Those steroids are nasty, aren't they? They can also cause muscle pain in addition to the Vincristine. Poor guy! Hang in there.
God bless,
Lisa Agee <www.caringbridge.com/page/ross>
Camden, AL - Tuesday, September 2, 2003 9:20 PM CDT
Just wanted to take a few minutes and let you all know you are in our thoughts and prayers...
In Love & Prayer...Eleasha & Cody <www.forcody.org>
- Tuesday, September 2, 2003 8:37 PM CDT
I hope Aidan is feeling better. Mitch's legs hurt once in a while due to the Vincristine also. Mitch goes to Orchards Elementary. School starts today. Yipee.
Paula (Mitch's mom) <www.caringbridge.org/wa/mitchellboy>
Vancouver, Wa - Tuesday, September 2, 2003 9:45 AM CDT
Oh you guys-----Sending you some cyber((((((hugs))))))!!!!
Love Kellie
- Monday, September 1, 2003 9:54 AM CDT
Aidan,
Sorry you had such a yucky week....hang in there buddy, hopefully the worst of it is over.
Christy
South Milwaukee, WI - Sunday, August 31, 2003 2:30 PM CDT
Elizabeth,
I stopped by today to see how everyone was doing. I am sorry to hear that Aidan had a tough week. Most people don't realize the up's and down's of the treatments. I will be singing praises with you as your son finishes up these last few times. :)
Jackson's mom, Michelle
- Sunday, August 31, 2003 10:41 AM CDT
Good to see all of you. We had a good time at Eagle Crest. Looking forward to our time with the boys. How was school this week Andrew? Love
Dad and Mom
Dave Munro
- Thursday, August 28, 2003 5:55 PM CDT
Hey Aidan, how was school yesterday? Ronnie missed it but went today, is he in for a shock when he realizes its all day... Glad to see you are doing great & hope you make lots of friends!
Angel Chris and all your friends at ~ Smile Quilts ~
chrisrusso_@hotmail.com
- Thursday, August 28, 2003 7:52 AM CDT
Dear Goodwin Family-
We just wanted to say "Hello" and let you know that we are thinking of you today. Take Care.
The Anderson Family <tandha@amerytel.net>
- Monday, August 25, 2003 2:09 PM CDT
Special thoughts of you all today!
God Bless you Dear Goodwins.
Love Kellie
- Monday, August 25, 2003 11:56 AM CDT
Aidan & family.... hope tomorrow goes off without a hitch. Will be thinking about you and keeping you in my prayers.
Christy
S. Milwaukee, WI - Sunday, August 24, 2003 4:51 PM CDT
Saying lots of prayers for you during this last spinal! I know it's mixture of emotions you are going through, but everthing will be FINE.
God bless,
Lisa Agee <www.caringbridge.com/page/ross>
Camden, AL - Sunday, August 24, 2003 4:17 PM CDT
Thinking of you...You all are in our thoughts and prayers...
In Love & Prayer...Eleasha <www.forcody.org>
- Sunday, August 24, 2003 1:19 AM CDT
Hi there Goodwin's! I just stumbled across Aidan's site in my favorites list today, I hadn't checked in on all of you since your Disneyland trip, how fun that sounded, what a treat! Glad things are going well and you are getting so close to the end of treatment. As you said Elizabeth, exciting and worrisome at the same time. Hopefully next year at this time you'll look back and this will seem like a long time ago that your daily life was so consumed with numbers, meds, blood draws and spinal taps! *yikes* I will pray that Monday goes as smoothly as possible and all results are great! Take care!
Cathy Coleman and family
PS Saw the post from the Malone's, looks like they have a new little one, how fun! My brother Mike is getting married on Sept. 6th so we'll be heading to Camas and hopefully seeing some of the high school crowd that I haven't seen in years!
Cathy Coleman <kitcat2068@hotmail.com>
Silverdale, WA - Friday, August 22, 2003 5:02 PM CDT
Hello Sweetie....
Angel Island Princess here to let you know that your Quilts Of Love family loves you very much. I will stop bye again real soon.
God Bless you,
Island Princess
Island Princess <islandprincess@quiltsoflove.com>
- Monday, August 18, 2003 6:36 PM CDT
Aidan & family,
Will be thinking of you in the days to come.....know it's a time of mixed emotions, but pray you will sail thru them with flying colors! Enjoy what's left of your summer, are you starting kindergarten this year? God bless you all!
Christy, Sean & Jackson
S. Milwaukee, WI - Monday, August 18, 2003 4:30 PM CDT
I stopped by to check in on you all and to say hello. A busy summer winding down, it sounds like. Wishing you peaceful days. :)
Jackson's mom, Michelle
- Thursday, August 14, 2003 4:11 PM CDT
Good luck to you... Laura
www.carignbridge.org/ca/coltonmeyer
- Thursday, August 14, 2003 2:29 PM CDT
Soon you will be closing the first in a long line of doors that sit before you. I'm sure there are days when you would love to slam it shut behind you, those that you hope you can close it gently, and even those days when you wish you could leave it open, just a bit.
I'm in constant struggle with my doors, finding out that most of them are actually swinging doors---can't slam em' shut, and can't leave em' open they just keep up their momentum and I have to figure out when to squeeze through them without getting whacked!
I will be thinkning about you extra on the 25th.
God Bless you!!!
Love Kellie
- Thursday, August 14, 2003 10:03 AM CDT
center>
What a great site! Have a wonderful school year. Elliesjane of QOL
Jane Tatum <janetatum@charter.net>
Hohenwald, TN - Saturday, August 9, 2003 3:12 PM CDT
beckyw <blessingsfa@yahoo.com>
springdale, ar usa - Saturday, August 2, 2003 3:09 PM CDT
Way to go Aidan. You are almost there. Sounds like you had a busy but fun week. We are looking forward to the week at Sunriver. See you tomorrow night or Sunday morning. Love.
Dad
Dave Munro <munros@pacifier.com>
Vancouver, WA USA - Friday, August 1, 2003 6:38 PM CDT
Greetings from Camas! So glad to hear Aidan's counts are where they need to be. Love the picture's too. The boys are sure growing up FAST. Alexa is now 7+ weeks old and we're loving every minute of parenthood. Can't for you to meet her! Take care and know that you all are in our thoughts and prayers!
Sean, Tammi & Alexa Malone <tamaramalone@hotmail.com>
Camas, WA USA - Thursday, July 31, 2003 9:56 AM CDT
Glad things are going well...Thanks for stopping by to check in on us...
In Love & Prayer...Eleasha & Cody <www.forcody.org>
- Thursday, July 31, 2003 7:23 AM CDT
Sounds like you are having a fun, busy summer! Gotta love those counts, too. It is so wonderful to read about you being so active. Keep it up!
God bless,
Lisa Agee <www.caringbridge.com/page/ross>
Camden, AL - Wednesday, July 30, 2003 9:20 PM CDT
Aidan,
You look really awesome in that picture!!! Glad you are having such a great summer...take care of yourself (and the rest of your family too!).
Christy
S. Milwaukee, WI - Tuesday, July 29, 2003 2:09 AM CDT
What a handsome little soccer player you are. :)
I hope that you are having a fun summer.
Jackson's mom, Michelle
Clear Lake, WI - Monday, July 28, 2003 11:47 AM CDT
Hi to all of you-Aidan looks great, good luck and God Bless.
I will stop by once in a while to read your updates.
Paula (Mitch's mom) <Phstyln@aol.com>
Vancouver, Wa USA - Monday, July 28, 2003 8:14 AM CDT
Hey Aidan, love the new soccer picture buddy! I hope you all are enjoying your summer!!! We found some bunnies in our backyard recently. Actually, our dog did - the kids were in the pool and she was barking like crazy under the pool deck. Finally when we checked there was a bunny nest with a baby bunny in it. Then after more looking through it we found 2 more. SO since i have 3 kids and there was 3 bunnies, they each named one. We left lettuce and water and carrots out there but it was never touched so we dont think the mom came back. About 2 days later we took them in to feed them and we had them a week, feeding them kitten milk from a kitten bottle or dropper. They were SO cute! They called them Jean, Robin and Nibbles. My son Gooch called his Jean, named after Jean Smart in XMen. They opened their eyes while we had them and by the end of the week we had them they were running all over, more running than hopping. I wish I had remembered that that you had a rabbit, we could have asked you for advice. My husband was convinced they were going to grow up and bite our fingers off, so we turned them over to a Childrens Museum that is a wildlife rehab center near us. I hope they are being taken care of, if they werent already released. I know the kids loved them and they really were cute!! That was our thrill for the summer – hope you are enjoying yours!
Angel Chris and all your friends at Smile Quilts
chrisrusso_@hotmail.com
- Sunday, July 27, 2003 5:33 PM CDT
I LOOOOOOVE THE SOCCER PICTURE!!! AIDAN YOU LOOK GREAT!!!
Our soccer days are around the corner---I can't wait!!! Kids n soccer---what a blast!!!
You guys have certainly kept yourselves busy this summer--it is going by too quickly isn't it!?!
Our week at VBS was wonderful as well! The kids are going to miss it, quiet evenings next week. Our theme was Super Cool Underwater Bible Adventure, kind of a Jesus/Nemo thing going on.
Aidan, Sammy got his Vicristine today too--we'll be thinking about you guys during steroid week. Only two cycles left!
Take Care Goodwins!!!
Happy summer days to you---103 degrees---don't send that eastward!!!
Love Kellie
- Friday, July 25, 2003 5:45 PM CDT
Great Pictures. See you in Sunriver.
Love.
Mom and Dad
Dave Munro <munros@pacifier.com>
- Friday, July 25, 2003 0:06 AM CDT
Hope all is well by you guys. Ron goes off treatment Sept 19th --- YIKES. Dad feels like "Sigh of relief, its over". I feel like "no, now the real test begins.. life without chemo" you know..? Who am I telling, of course you know!
Chris ~ Gooch's Site ~
- Thursday, July 24, 2003 2:13 PM CDT
Hi, thanks for visiting Mitch's web page....A fellow Vancouverian.. Good luck to your son and your family. We know alot of people who go to Crossroads Church. We will also pray for you.
Paula (Mitch's mom) <Phstyln@aol.com>
Vancouver, Wa USA - Wednesday, July 23, 2003 11:11 AM CDT
Stopping by to say hello. I am happy to hear that the ultrasound results came back good. Wishing you a wonderful weekend.
I love that black and white photo of Aidan. Too cute. :)
Michelle E.
- Friday, July 18, 2003 3:19 PM CDT
Elizabeth,
Glad to hear you got good news fm the Doc....I'm sure VBS is keeping you busy, but what a great way to spend a week! Just wanted to stop by & get an update, as always will keep Aidan & the rest of the family in our prayers.
Christy, Sean & Jackson
S. Milwaukee, WI - Thursday, July 17, 2003 9:05 PM CDT
Hi Aidan! Sounds like you're having a fun summer so far...keep it up!!!
Cameron's Page
Lots of Love!!!
~Angel~Sheri <yankee_cajun2001@yahoo.com>
Lafayette, LA - Wednesday, July 16, 2003 10:23 PM CDT
Just wanted to stop by and say hi! Hope you have fun in VBS. I always liked going to those too. I will be praying for you and your family that your mom tests come back with flying colors. Take care and keep having a great summer. Don't swim to much you might turn into a fish:)
Christine Smith <csmi@triarelectric.com>
Tacoma, WA - Friday, July 11, 2003 11:22 AM CDT
Elizabeth,
We'll be praying that your test results come back ok.....it sounds like just knowing the end is in sight brings it's own emotions with it. I can't imagine how overwhelming it all must be, but it seems like you have dealt with it beautifully. Knowing you have the strength of the Lord makes getting thru each day possible and I can tell by your journal entries that you rely heavily on Him. Hang in there Elizabeth, your family has an awesome testimony and it has touched my heart as well as many others. Thanks for being so open & transparent, it is an incredible witness to faith and also for allowing us to accompany you all on your journey. I think by sharing each other's burdens, even if only in prayer is what the Lord had in mind when He commissioned the church. Stay strong and God Bless you all....
Christy
S. Milwaukee, WI - Friday, July 11, 2003 10:54 AM CDT
Elizabeth,
I know the fear of being off-treatment coming up must be like having a security blanket yanked away....but never forget how far you've come! Sounds like your family is staying busy this summer. I'll be praying that you get good test results.
God bless,
Lisa Agee <www.caringbridge.com/page/ross>
Camden, AL - Friday, July 11, 2003 8:10 AM CDT
*HUGS*
- Wednesday, July 9, 2003 9:55 AM CDT
Dear Aidan & family,
Sounds like you had a wonderful 4th of July! Hope you are feeling strong & enjoying your summer. Please know that you & your family remain in our prayers. I'm sure that it has been an incredible journey for you all over the last 3 years. God Bless!
Christy
S. Milwaukee, WI - Monday, July 7, 2003 9:57 PM CDT
Wishing you all a wonderful weekend. Happy 4th!
Elizabeth---I will try to mail that book out on Monday.
I am sorry that it took so long. We were waiting for the
2nd shipment...and waiting...and waiting. :)
Good news is that it was a huge success. Lots of families will be helped from it.
Jackson's mom, Michelle
- Thursday, July 3, 2003 10:20 PM CDT
Hello to Aidan & Andrew & the whole Family!
I just wanted to stop by and check on you and wish you all a very happy 4th of July from all of us at Quilts of Love~
~Hugs~
Jean
Jean Ilderton - Quilts of Love <jean@quiltsoflove.com>
Tucson, AZ - Thursday, July 3, 2003 9:44 PM CDT
I don't always understand all the technical lingo on your updates, but it sounds like it is all good news, especially the part about Aidan growing an inch! Swimming, soccer and VBS...how great that you are all getting to do "normal" things this summer. Hope you all have a wonderful 4th of July and that things continue to go well for everyone. God Bless!
Christy
S. Mil, WI - Monday, June 30, 2003 9:06 AM CDT
I am thrilled to see that things are going well there.
I just wanted to drop by and wish you a safe and healthy 4th of July
Angel Chris and all your friends at Smile Quilts
chrisrusso_@hotmail.com
- Sunday, June 29, 2003 10:49 AM CDT
Aidan, keep eating those pickled beets and you will continue to grow each month. Have a great time in Sun River. Love
Grandpa
Dave Munro <munros@pacifier.com>
- Sunday, June 29, 2003 0:02 AM CDT
So happy to hear that things are going so well for you all!!!
Thinking of you!!! Kellie
- Saturday, June 28, 2003 10:28 PM CDT
Sounds like you are having a fun summer. So great to read that you're doing well and keeping good counts!
God bless,
Lisa Agee <www.caringbridge.com/page/ross>
Camden, AL - Friday, June 27, 2003 11:29 PM CDT
HEY! Just wanted to stop by and check on you. I looked at your photo album again. Such nice pictures of you and your family. Hope your counts continue to stay good and I will be praying for you and your family.
Christine <csmi@triarcelectric.com>
Tacoma, WA - Monday, June 23, 2003 6:18 PM CDT
Ahhhhh summer! Sounds like it is going to be a wonderful one for all of you. Enjoy it and know we we will continue to lift Aidan up in prayer. Looks like he is on the downhill slide now and the finish line is in sight!! I'm sure this will be your best summer yet!
Christy
So. Milwaukee, WI - Friday, June 20, 2003 11:49 AM CDT
HI AIDAN!!
we hope you are having a fun summer! baby aiden is running around the house being silly! i asked him if he had something for me to type and he stopped and stood in the kitchen and blew you kisses....so here goes......mmmmmmmwhaaaaaa.....mmmmmmmmwhaaaaaaa~!!
we are praying for you!
Amy and Aiden <kkat524@yahoo.com>
Pollok, Texas USA - Friday, June 20, 2003 10:45 AM CDT
Hi Aidan! I'm a new quilting angel and wanted to stop in to say HI! You must be really proud of your brother doing so well on his report card! And you don't have that much longer to go with your treatment either! October will be here in no time! Know you're going to be a real fish and enjoying swimming lessons so much! Give each other a gentle angelhug from me!
Angel Koala aka Elaine <koa1a@bellsouth.net>
Florida's Space Coast, USA - Tuesday, June 17, 2003 6:59 PM CDT
Thank you Elizabeth for the sweet card yesterday. It was so nice to hear from you and for the special little bag that you made for Jack. :)
Thank you for always keeping my son in your heart and thoughts...as I also do for your's.
I hope that you enjoy your cookbook. I will get the order in later next week and then send it to you. I will stop by again soon. Take care.
Michelle E. <michellee@whiteeaglebuildingsystems.com>
- Tuesday, June 17, 2003 5:00 PM CDT
Greetings Goodwin Family~
We just wanted to Wish You All A Beautiful Weekend.
We wanted to wish you well in everything. Sounds like you are off to another busy Summer. Baseball is so fun. Enjoy the weekend.
Take Care.
Heather & Family <tandha@amerytel.net>
- Friday, June 13, 2003 11:21 PM CDT
I was vistiting Aaryn Kelly's site. Aaryn goes to preschool with my son,Dominic. Someone had signed into his guestbook with a link to being able to adopt a kid. I clicked onto your name! Boy did I get a smile to see that CUTE picture on the front. Goofy is my favorite! I look forward to reading your journals and getting to know you over emails. I will stop by again real soon.
Christine <csmi@triarcelectric.com>
Tacoma, wa - Friday, June 13, 2003 4:51 PM CDT
I am glad to see things are going well there and hope you know we are all pulling for you and praying for you!
Chris
~ Gooch's Site ~ * * ~ Adopt A Kid's site ~
- Tuesday, June 10, 2003 8:50 PM CDT
Stopping by to say "hi". :) You are always in my thoughts and prayers.
Michelle E.
Clear Lake, WI - Sunday, June 8, 2003 12:07 AM CDT
Just checking in..... it was so uplifting to read your last entry. It seems like you are finally heading out of the valley and life sounds so good. We pray that the road ahead remains as trouble free as life can possbily be. Thanks for sharing w/us, it helps put it all into perspective whenever we hit a bump. It can always be worse. Have a wonderful, blessed summer!
Christy
So Milwaukee, WI - Sunday, June 8, 2003 0:15 AM CDT
We had a great visit. Wow, moving back to the west side would really be nice, however, we only do yard work on an occasional basis. Don't book us weekly.
Love. Mom and Dad
Dave Munro <munros@pacifier.com>
- Saturday, June 7, 2003 1:36 PM CDT
Just checking in on you guys...hope that Aidan is feeling better and that was a one time episode. Keeping you in my prayers!
God bless,
Lisa Agee <www.caringbridge.com/page/ross>
Camden, AL - Friday, June 6, 2003 7:38 AM CDT
Hey guys : ) I have been thinking about you. I know I don't sign the guestbook a lot but I think and pray often. Your doing an awsome job at fighting. Keep your head up. Looks like you had a great time, I'm glad.
Love and Hugs
Amy*
www.caringbridge.com/page/amymareck
amy mareck
- Monday, June 2, 2003 7:38 PM CDT
We are looking forward to seeing you next week.
Aidan, how about a game of putt-putt golf and some chicken strips at MacDonalds?
Love. Grandpa
Dave Munro <munros@pacifier.com>
- Friday, May 30, 2003 10:54 PM CDT
Aidan & family,
Haven't been able to check in on you recently since we were in the process of moving to WI fm Florida.... sounds like a lot has been going on, but mostly good stuff. Glad you had a great time at Disney. We'll continue to keep you in our prayers, hang in there!
Bryan, Christy, Sean & Jackson
South Milwaukee, WI - Friday, May 30, 2003 9:58 PM CDT
I sure hope your chemo went well, my prayers continue. Love Angel Sky
Angel Sky
- Thursday, May 29, 2003 12:36 AM CDT
Aidan,
I'm so sorry you've been feeling so crummy....I hope by now you are on the mend! You can take another trip ~ you just concentrate on getting better!
God bless,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Monday, May 26, 2003 2:33 PM CDT
Hey...I had no idea that DisneyLand could cause pnemonia...they need to post warning labels like the ones on the dies of cigarettes :):):):):):):) Just kidding...
Anyway...I was really glad to read you all had such a a wonderful time at Disney on your Make A Wish...
Sorry to read that Aidan has pnemonia...we will keep him up in prayer...
In Love & Prayer...Eleasha & Cody & Greg & Riley <www.forcody.org>
- Sunday, May 25, 2003 8:23 PM CDT
Praying for the "fever bugs" to go away.
Wishing you a peaceful weekend.
The Espeseth family
- Saturday, May 24, 2003 7:43 PM CDT
I found your site via the Chubby Chica page. I became involved in caring bridge via my precious little friend Dustin, who had ALL.
I too, have an Aidan (spelled Aiden) we are including Aidan in our prayers. My thoughts and prayers are with you...be strong.
amy and aiden <kkat524@yahoo.com>
TX - Wednesday, May 21, 2003 9:30 PM CDT
WOW, what a trip. Aidan the picture of you with the
"two" Goofys is good. Enjoy the Mariner game and we will see you in a couple of weeks. Love.
Gram and Gramps
Dave Munro <munros@pacifier.com>
- Tuesday, May 20, 2003 4:03 PM CDT
Hello my name is Jenna, and I was born with a rare bone diease. I got to go to DisneyLand for a day wiht the dream lift foundation. We got our own deputies from the Orange County Sherif Department. It was a fun day, so I can imagine the fun you had on your trip.
my webpage is: http://www.matmice.com/home/fighterandchampion
Jenna <hockeykid@telus.net>
Kamloops, BC Canada - Saturday, May 17, 2003 6:37 PM CDT
Wow, Have a blast, we know you deserve it. Trevor still can't wait to do his make-a-wish (He has ALL too). Can't wait to see the pictures. Have lots of fun and tell Goofy the Coe's said hi.
The Coe's <caringbridge.org/va/trevorco>
- Friday, May 16, 2003 2:20 PM CDT
Hello there! How cool that you are getting a trip! take care! love, Laura
www.caringbridge.org/ca/coltonmeyer
- Wednesday, May 14, 2003 9:26 PM CDT
Happy Mothers Day to you Dear Elizabeth!
Wishing you your perfect day. Take enough time away from packing those suitcases for some special mommy moments.
Have a beautiful, wonderful, restful vacation!!!
Having just gotton back from Florida ourselves, I can promise you an amazing break. You won't believe how refreshing it will be to take yourselves away from everything. Our week away gave us a fresh start; the energy we needed to get through the next four months, you'll see...I am soooo excited for you guys!!! Enjoy every moment, and take lots of pictures!!! I can't wait to hear your stories!!!
God Bless you dear family.
Take Care, and have FUN!!!
Love Kellie
- Sunday, May 11, 2003 10:18 AM CDT
Elizabeth,
Happy Mother's Day to you.
How exciting the Disneyland trip. I hope you all have a wonderful time. That will be so good for you all to get away and have fun.
We are going to Disneyworld in October. It seems so far away. The kids can't wait.
Have a super time on your trip.
We will be thinking of you all.
Love,
Heather and Family <tandha@amerytel.net>
- Sunday, May 11, 2003 1:29 AM CDT
HAPPY MOTHER'S DAY AND BON VOYAGE.
Have a great trip and Aidan, give Goofy a big hug from your grandpa. Love.
Mom and Dad
dave Munro <munros@pacifier.com>
- Sunday, May 11, 2003 0:07 AM CDT
HAPPY MOTHER'S DAY TO YOU...HAPPY MOTHER'S DAY TO YOU!!!
In Love & Prayer...Eleasha & Cody & Greg & Riley <www.forcody.org>
- Saturday, May 10, 2003 9:12 PM CDT
Have a GREAT time on your trip! I can't wait to hear all about it when you get back.
God bless,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Saturday, May 10, 2003 10:25 AM CDT
Hi Aidan, I am Sky from QOL, I am one of the angels that will stop by and check on you often, just to see how you are and to leave a little guestbook gift! take care & God bless.
Angel Sky
- Friday, May 9, 2003 11:33 AM CDT
Have a great trip. We are excited and happy for all of you. Love.
Mom and Dad
Dave Munro <munros@pacifier.com>
- Thursday, May 8, 2003 12:54 AM CDT
Elizabeth--I am so happy for Aidan & your family, that you will be able to get away and enjoy some time together on this trip. It will be so much fun! I can't wait to read all about it.
A special thank you for being that one that always remembers Jackson and always lets us know that you care. You are special. :)
Michelle Espeseth <http://www.caringbridge.com/wi/jacksons.journey>
Clear Lake, WI - Wednesday, May 7, 2003 9:34 PM CDT
Just checking in w/you...sounds like a busy week, but how exciting! I enjoy checking your website each week and knowing that even though we don't know each other, we are connected thru prayer. Have a great time and God Bless you
all!
Christy & family
Odessa, FL - Wednesday, May 7, 2003 8:10 PM CDT
I saw a news clip of the USS Abraham Lincoln's homecoming. Thought of you guy's with a smile in my heart!!!
Welcome home Unlce David
Love Kellie
- Wednesday, May 7, 2003 1:53 PM CDT
I just had to stop by to help you celebrate the coming of summer! love ^A^ Toto
^A^ Toto
- Monday, May 5, 2003 4:17 PM CDT
It's been far too long since my last visit, actually I visit all the time, faithfully making my rounds to your journal entries, and always keeping you close to my heart, I just haven't signed in in a while...
I'm so sorry to learn about the loss of your grandma. Grandma's are the very best, so very special.
You always hear our mom's talk about how being a mom is amazing but being a GRANDMA is even better, how can it be better? Well that's what they say...I think the same holds true of our perspective on them, oh how we love our mom's but grandma's, now that's something to be hold.
I've gained somewhat of a new perspecive on grandparents as I've watched the relationships between my children and parents unfold over the years. They will have many memories to share and stories to tell of oneanother.
There's just something about grandma's...
Hoping all is well with Aidan and the rest of you...summer vacation is practically sitting on us----I can't wait. It brings the end that much closer!!!
Take care---I'll be sending extra warm thought's to you this mothers day.
Love Kellie
- Monday, May 5, 2003 9:13 AM CDT
Just checking in to see how you were doing...I am so sorry about all that you have had to deal with lately...but I must say that I love your outlook and your entry is nothing but a true witness to the way it should be...we will continue to keep you in our thoughts and prayers...stay well...
In Love & Prayer...Eleasha & Cody & Greg & Riley <www.forcody.org>
- Friday, May 2, 2003 9:14 PM CDT
Aidan did more than allright. He really adjusted well to all the people and noise and the hectic pace. We are looking forward to seeing a baseball game soon with both boys. Love.
Dad
Dave Munro <munros@pacifier.com>
- Friday, May 2, 2003 6:26 PM CDT
So sorry to hear about your Grandmother, but to know that she is with the Lord now probably brings you such peace. Have been praying for an extra dose of that peace for you and that you would all make it through the service and all that goes with it. Hang in there...
Christy, Bryan, Sean & Jackson
Odessa, FL - Wednesday, April 30, 2003 3:02 PM CDT
We pray for comfort for your family.
M.Espeseth family
- Saturday, April 26, 2003 7:43 PM CDT
The front picture is awesome!!
Visit Katia's Page and sign her guestbook :) (Leukemia AML M4)
Tracy Solomon
- Friday, April 25, 2003 6:06 PM CDT
Elizabeth,
I love the picture of Aidan! I'm praying that your Grandma has peaceful days remaining and that your entire family has peace.
God bless,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Friday, April 25, 2003 9:08 AM CDT
Elizabeth---I hope that you all had a great weekend. He is risen. Isn't that amazingly special when one really "gets" that revelation? Easter isn't about that bunny :) It's all about Him.
I know that you will be busy with the upcoming cancer walk. They are quite an experience to be involved with, especially after enduring all that you have with Aidan. I wish you a special time with great support.
Will write again soon. Take care.
Michelle, momma to Jackson Ben
- Tuesday, April 22, 2003 5:32 PM CDT
What a beautiful picture of Aidan.... so full of life and your journal entry says it all, "He is risen". Even though I haven't met any of you, I am honored to pray for you. God Bless....
Christy, Bryan, Sean & Jackson
Odessa, FL - Tuesday, April 22, 2003 3:10 PM CDT
Aidan,
Hope you had a wonderful Easter!
God bless,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Monday, April 21, 2003 9:10 AM CDT
HAPPY EMPTY TOMB DAY!!!!! HOPE YOURS IS FILLED WITH MANY NEW BLESSINGS!
In Love & Prayer...Eleasha & Cody & Greg & Riley <www.forcody.org>
- Sunday, April 20, 2003 4:45 PM CDT
HAPPY EASTER, AIDAN AND FAMILY!
WONDERFUL NEWS THAT THE USS ABRAHAM LINCOLN IS COMING HOME! I HAVE A SON ON THE BRAND NEW USS MASON! THANKFULLY, HE HASN'T GONE OVERSEAS YET! GOD BLESS OUR MILITARY!!
Love,
Eva Shimmons <KWfan4ever@yahoo.com>
Marcellus, Mi - Sunday, April 20, 2003 1:13 PM CDT
Just hopped by to say "HAPPY EASTER". Wishing you a Beautiful Easter. Filled with lots of joy and goodies.
The Anderson Family <tandha@amerytel.net>
- Sunday, April 20, 2003 12:49 AM CDT
AIDAN... HAPPY EASTER....I HOPE YOU FIND MANY EGGS... :)
Jodie Summers..... http://www.caringbridge.org/ca/lindsayjohnson <jsummers1@bak.rr.com>
Arvin , California United States of America..."Pray for Our Troops" - Saturday, April 19, 2003 11:53 PM CDT
WELCOME HOME DAVE!!
HAPPY EASTER!!!
Visit Katia's Page and sign her guestbook :) (Leukemia AML M4)
TRACY SOLOMON
- Saturday, April 19, 2003 3:19 PM CDT
Aidan,
Sounds like a week full of good news, how wonderful!!!! Won't stop praying for the safe return of your uncle Dave or that you will continue to grow stronger & healthier day by day. May you & your family & friends have a beautiful, blessed Easter!
Christy & family
Odessa, FL - Thursday, April 17, 2003 3:04 PM CDT
Hey there Aidan, I am glad to see that you are doing well. I hope that what Amie & I set out to do with the Adopt A Kids Site is working, and you have more people praying for you and visiting your site. I just wanted to take this opportunity to wish you a Happy & Healthy & Blessed Easter/Passover/spring time, whatever you prefer!!
Chris
~ Gooch's Site ~ * * ~ Adopt A Kid's site ~
- Thursday, April 17, 2003 11:56 AM CDT
Just dropping by to say hi...Glad to read that things are going so well...please know that I check in every day it has just been really crazy around here since we have all of our children here and they told us we can go home :):):):):):) NEVER A DULL MOMENT, I tell ya!
In Love & Prayer...Eleasha & Cody & Greg & Riley & Jeremy & Marina <www.forcody.org>
- Thursday, April 17, 2003 6:47 AM CDT
Hi there ^A^ Toto here hopping in to wish you a very Happy Easter!
Angel Toto
- Wednesday, April 16, 2003 7:50 PM CDT
We are so pleased to see God answering our prayers for Aidan.
Doug and Sharon Nyhus <denyhus@hotmail.com>
Silver Spring, MD USA - Wednesday, April 16, 2003 8:11 AM CDT
Greetings to the Goodwin family! We just wanted to leave a note to wish you all a very happy and very blessed Easter weekend.
Michelle and Mike Espeseth & family <http://www.caringbridge.com/wi/jacksons.journey>
- Tuesday, April 15, 2003 8:06 AM CDT
What Great news about uncle Dave!!! That'll be a homecoming I would love to see.
I'm so happy to see all is well for you right now--love reading good reports about our kids.
Love Kellie
- Monday, April 14, 2003 9:37 AM CDT
Hey sweetie, I am glad to see that you are doing well. Let me take this opportunity to wish you a Happy & Blessed Easter and let you know how much everyone cares about you and everyone at Smile Quilts is thinking of you and is praying for you. So glad your uncle is on his way home, I hope they all are soon!
Angel Chris and all your friends at Smile Quilts
chrisrusso_@hotmail.com
- Monday, April 14, 2003 1:12 AM CDT
Hello My name is Jenna, and i am inspired by Aidans story. He is a real warrior and fighter. i will keep him in my prayers. I was born with a rare genetic uncureable bone disease. It effects all my bone joints, and I have calium deposits on all my joints, so there for I have chronic pain 24/7. it is hard sometimes fighting and putting up wiht my pain, and meds, but I never give up.
my webpage is: http://www.matmice.com/home/fighterandchampion
Jenna
Jenna <hockeys_life@hotmail.com>
Kamloops, BC Canada - Monday, April 14, 2003 0:15 AM CDT
Sounds like a great weekend to me! What great counts! I'm also so happy to hear that your uncle will be coming home soon. That will be a big celebration, I'm sure.
God bless,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Sunday, April 13, 2003 10:31 AM CDT
Way to go Aidan. We sure had a good time with all of you on your latest visit. Look forward to coming over in a couple of weeks. Love
Dad and Mom
Dave Munro <munros@pacifier.com>
- Saturday, April 12, 2003 6:41 PM CDT
HIYA! I brough a friend by to play with you on your guestbook. I pray the labs are going okay today. Love, Tracy
Visit Katia's Page and sign her guestbook :) (Leukemia AML M4)
Tracy Solomon
- Friday, April 11, 2003 10:48 AM CDT
Sounds like you had a wonderful day!! Happy Beleated Birthday!! YOur bouys are so handsome.. I have a redheaded little girl...They are adorable...We will pray for "GOOD" results tomorrow..Have a great day!! :)
Jodie Summers..... http://www.caringbridge.org/ca/lindsayjohnson <jsummers1@bak.rr.com>
Arvin, California United States of America..."Pray for Our Troops" - Thursday, April 10, 2003 2:04 PM CDT
Just checking in, sounds like you all had a wonderful Saturday! Happy Birthday Andrew and many more to come! Aidan, will be having good thoughts for you for Friday, you are definitely in our prayers. Take care...
Christy & family
Odessa, FL - Wednesday, April 9, 2003 1:58 PM CDT
I am so glad you all had so much fun this weekend...I checked in on Saturday but did not have time to sign...I wanted to make sure that I came back to let you all know you are in our thoughts and prayers...
In Love & Prayer...Eleasha & Cody & Greg & Riley <www.forcody.org>
- Monday, April 7, 2003 4:31 PM CDT
Boy, you guys know how to pack in a full day, don't you? Sounds like lots of fun, though. Happy birthday, Andrew! We almost share birthdays...mine is today, the 6th.
God bless,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Sunday, April 6, 2003 11:53 PM CDT
hey..just read your story...i also had cancer at the age of 9..i have now been in remission for 5 years..
lori-lynn meehan <lori_lynn_m@hotmail.com>
st.john's, canada - Sunday, April 6, 2003 5:45 PM CDT
WOW. Sounds likea great day and lots of fun. . Happy Birthday Andrew. We are looking forward to your visit
on Tuesday. Hope the weather cooperates. Katherine
is anxious to see all of you as well. Love.
Mom and Dad
Dave Munro <munros@pacifier.com>
- Sunday, April 6, 2003 9:18 AM CDT
Good Morning Elizabeth. It sounds like you had a very fun filled day. :) Happy Birthday wishes to Andrew! 7 years old...getting to be such a big guy. I am sure that he is an awesome baseball player. I was just thinking this morning how many of us mom's have become close, and that strong support for each other. It is strange how fast time goes by. You have been so wonderful to us. We keep Aidan in our prayers. It is so exciting to see his treatment nearing the end. He surely is a survivor. God bless. I wish you a all a great week.
Jackson's mom, Michelle <mespeseth@whiteeaglebuildingsystems.com>
Clear Lake, WI - Sunday, April 6, 2003 8:36 AM CDT
Happy Birthday Wishes To Andrew. Sounds like you all had an awesome day!!!
Heather & family <tandha@amerytel.net>
- Sunday, April 6, 2003 0:34 AM CST
Hello there! My name is Laura, and my six year old is going blind from an incurable eye disease, retinitis pigmentosa. Somebody from our community invited us to ride horses and Colton and Bronson loved it! We love the pic of you on the animal- what a cutie you are! Take care and good luck to you. Colton's family
www.caringbridge.org/ca/coltonmeyer
- Saturday, April 5, 2003 9:28 AM CST
Hello Aidan and Family.
We Just Wanted To Wish You A Beautiful Weekend.
Way to go Andrew 2 for 2 !! Baseball is such a fun sport to play and watch. I love to watch my boys play. It won't be long and Aidan will be playing too.
We think of you all everyday. Enjoy your weekend.
Take Care..
Heather & Family <tandha@amerytel.net>
- Friday, April 4, 2003 10:33 PM CST
HOPEFULLY THINGS WILL CALM DOWN SOON. HOW LONG DOES HE STAY ON THE STEROIDS? LOVE, TRACY
Visit Katia's Page and sign her guestbook :) (Leukemia AML M4)
TRACY SOLOMON
- Thursday, April 3, 2003 1:34 PM CST
Hey Aidan & Family,
Just fluttering by to let ya know you're in my heart, thoughts & prayers. With angel hugz, kisses & friendship...Angel Red
Angel Red Myst
Phoenix, Az - Thursday, April 3, 2003 11:02 AM CST
It is amazing to me that with all that you are enduring, (Aidan's illness, and the added burden of worrying abt a loved one overseas) you all are carrying on with everyday life and taking what comes along in stride. My prayer for you all is that you will have the endurance you need, the rest you deserve and the peace that surpasses all understanding. And enjoy those wonderful ballgames, because that is what life is made of!!! Take care and God Bless....
Christy & family
Odessa, FL - Wednesday, April 2, 2003 9:19 PM CST
Ahhhh! Baseball season, isn't it great. My grandson swung the bat today for the very first time in three games and guess what?? He hit the ball! He did not beat it to first base though but at least he contacted. Such a struggle for him, but maybe now it will get easier. Hoping you guys have a good season and that Aidan gets stronger and finishes treatment never to have to go it again. Prayer are being said that he heals.
Love is the best medicine!
Ivy
ivy....www.caringbridge.org/wa/cameronboyd <poisenivj@aol.com>
lynnwood, wa usa - Tuesday, April 1, 2003 3:30 AM CST
Aidan,
I know you are having a blast with baseball! Be sure and tell Mom to put some pictures on your page of you in your uniform. Ross starts practice tomorrow and is so excited. I'll let you in on a little secret....it's lots of fun for the parents too! I'll be keeping your uncle in my prayers.
God bless,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Sunday, March 30, 2003 8:34 PM CST
HI! Just thought I would take a few minutes to drop by and see how things were going...That is so cool that you only have 7 more hospital visits for YUCKY stuff...it is great to read that Aidan is such a trooper with all of the pokes...I don't know how he does it every time...tell him he is a stronger man than I would be (if I were a man) We continue to keep you and your family in prayer...
In Love & Prayer...Eleasha & Cody & Greg & Riley <www.forcody.org>
- Sunday, March 30, 2003 8:39 AM CST
Aidan & family,
Just checking in on you this week, glad your hospital visit is over, sounds like you were a real trooper! Will keep you and your family in our prayers, especially your Uncle serving overseas. We're an Air Force family and every day we think about our friends who are also so far away from home. God Bless....
Christy & family
Odessa, FL - Saturday, March 29, 2003 3:14 PM CST
Not much longer to get out of there. I am glad you have a good friend there. That must make it a little better. Love, Tracy
Visit Katia's Page and sign her guestbook :) (Leukemia AML M4)
Tracy Solomon
- Saturday, March 29, 2003 11:25 AM CST
Hope all is well there with you family here and overseas...
Chris ~ Gooch's Site
- Friday, March 28, 2003 9:01 AM CST
Hello Goodwin Family
I just wanted to let you know that we are thinking of you and your family and David. Our thoughts and Prayers are with you. We pray that Aidan continues to do well in his battle with Cancer and David returns home safely. We wish you a good day and many more.
Heather & Family <tandha@amerytel.net>
- Thursday, March 27, 2003 8:42 AM CST
Keeping you all in my heart and prayers during this time. May God continue to watch over you and hold Uncle David gently in his hands.
Peace to you all dear friends.
Love Kellie
- Wednesday, March 26, 2003 10:18 AM CST
Adian I just wanted to send a little smile your way. You will make a wonderful baseball player. Have fun riding bikes and enjoying the sunny weather.
HUGS!
Kim ~ Hannah's page
- Friday, March 21, 2003 11:37 PM CST
Aidan,
It's always great to hear good news! Glad you are feeling better and enjoying some nice spring weather, it feels like spring has bypassed us here in Florida and we are in the middle of summer already!! Will keep checking in on you and saying a prayer for you and your family!!
Christy
Odessa, FL - Wednesday, March 19, 2003 3:01 PM CST
Come on Counts!!! Get up There!!!
Kellie
- Wednesday, March 19, 2003 9:49 AM CST
Just checking in. :) Glad to hear everyone is doing well and enjoying some good weather!
Michelle E. <http://www.caringbridge.com/wi/jacksons.journey>
- Tuesday, March 18, 2003 6:10 PM CST
JUST DROPPING BY TO SAY HELLO AND WISH YOU HAPPY ST. PATRICKS DAY. WE ARE PRAYING FOR YOU TODAY! LOVE, THE SOLOMON FAMILY (KATIA'S FAMILY)
KATIA'S PAGE (LEUKEMIA AML M-4)
Tracy
- Monday, March 17, 2003 1:08 PM CST
Happy St. Patricks day Aidan and Andrew!!! I think I saw a little Leprechaun in my yard this morning looking for a patch of clovers and pot of gold. If there's one of those out there I hope I find it before he does.
Hoping your all well, especially sweet Aidan! Have a great day!
Kellie
- Monday, March 17, 2003 10:07 AM CST
Aidan,
Happy St. Patrick's Day! Make sure to wear a bit of green today or you just might get **pinched**! Just stopping by to let you know you are in my thoughts and prayers.
God bless,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Monday, March 17, 2003 9:32 AM CST
Hello Aidan, Just wanted to say hi and let you know that I am thinking of you. Hugs and Prayers, Becky-QOL
Becky <beckybrown_1976@yahoo.com>
Pineville, WV USA - Saturday, March 15, 2003 8:41 PM CST
Hi Aidan!!! Just dropping by to check up on you and leave you our thoughts and wishes.
You dont have to be Irish, I'm not, to have a Happy St. Patrick's Day!!!
Angel Chris from Smile Quilts
chrisrusso_@hotmail.com
- Saturday, March 15, 2003 8:28 AM CST
Hi, you don't know me, but I found your name and story on an internet search page. I have a nine year old cousin who has rhabdomyosarcoma and is being treated in New York. We are keeping track of her progress through the caring bridge site as well! I wish you and your family all of the goodness in the world, and I am sure your counts will come up soon. God loves you and I am positive things will be better. I only hope you will be a model for all other children and adults who also suffer from cancer. You are such a brave little child! God Bless, Devan
Devan Gunderson <devangun@hotmail.com>
La Grange, Ky USA - Thursday, March 13, 2003 9:07 PM CST
Hey ya'll just checking in to see how things are going...I am sorry to hear about the sudden drop in counts probably some chemo or bug messing up the program...we have had a rough couple of days but we will pull through...with lots of prayers and faith...we always do.
In Love & Prayer...Eleasha & Cody & Greg & Riley <www.forcody.org>
- Thursday, March 13, 2003 7:04 PM CST
Dear Aidan & family,
Just a quick note to let you know that I have "adopted" you!!! I have been visiting the Caring Bridge site for one of my friend's son and his grandmother suggested adopting other kids in need of prayer. As soon as I saw your name on the list, I knew I had to pick you, you see, you have the same name as my grandson, so I knew right away you were special. I also have a little boy not much older than you, so that made you extra special!! I will be honored to pray for you as often as possible and I look forward to learning more about you! Hang in there little guy, my friend's son has had a wonderful miracle and God is still in the healing business. Take care.
Christy Lee <chrilee@aol.com>
Odessa, FL USA - Thursday, March 13, 2003 2:48 PM CST
It's amazing how quickly things can change, isn't it? I'm glad that Aidan is feeling good, and hopefully his counts will rebound soon. Keeping you in my prayers...
God bless,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Thursday, March 13, 2003 9:24 AM CST
So goes another day huh?!? Sorry to hear about those low, low counts...winter bugs...Do you think it will be like this next winter too, it's hard to imagine what our next "phase" will be like. Hopefully the chemo break will prove effective and give Aidan a chance to rebound!!! Here's to staying healthy!!! Spring is right around the corner (although it's snowing as I sit and write this), may it bring to us some fresh air!!!
Andrew, I'm with you sweet boy..."thank you God..."
God Bless you and those you love. Kellie
- Wednesday, March 12, 2003 11:11 PM CST
Just a quick note to let you know you all are in our thoughts and prayers...
In Love & Prayer...Eleasha & Cody & Greg & Riley <www.forcody.org>
- Wednesday, March 12, 2003 6:54 AM CST
We hope that the cough is getting better!
Thinking of you all. :)
Michelle and Mike Espeseth & family
- Tuesday, March 11, 2003 11:39 AM CST
I sure hope & pray you are getting over the ear infection and the cough! love & prayers Angel Toto 
Angel Toto
- Monday, March 10, 2003 0:04 AM CST
Hello Sweetie....
Angel Island Princess here stopping by to let you know your Quilts Of Love family loves you and are thinking of you. I hope you have a wonderful weekend. You are in our thoughts and prayers.
Hugs,
Angel Island Princess
Island Princess <islandprincess@quiltsoflove.com>
- Sunday, March 9, 2003 3:29 PM CST
I want you to know of my visit and the prayers I offer that Adian continues to do well with the treatment and returns to the healthy guy he should. I also sit at my computer screen and pray for these families who have to endure the war on these horrid diseases that rob kids of their childhood. It is so hard to feel so helpless.
Love is the best medicine!
Ivy....www.caringbridge.org/wa/cameronboyd
Ivy <poisenivj@aol.com>
lynnwood, wa usa - Sunday, March 9, 2003 12:14 AM CST
thinking of you... Colton and family
www.caringbridge.org/ca/coltonmeyer
- Sunday, March 9, 2003 12:03 AM CST
Hey there Aidan and family...so sorry to hear you had such a rough week but I am glad to hear that your doc has gotten you under control for the most part...we will keep saying our prayers for you every night as we do always...hope you all have an excellent weekend with no rain...little wind and lots of fun filled love!
In Love & Prayer...Eleasha & Cody & Greg & Riley <www.forcody.org>
- Saturday, March 8, 2003 7:35 PM CST
Good Evening to the Goodwin's! Just stopping by to say hello. Glad to see that you all are doing well. Thinking about you Elizabeth, and thanking you for your continuous support.:) God bless.
Jackson's mom, Michelle
- Friday, March 7, 2003 6:14 PM CST
Aidan I am so glad to see a good entry on you. Your treatment is almost done!
I just wanted to drop in and let you know your new friends at Smile Quilts will be checking in on you periodically and will keep you in our thoughts & prayers always!
Angel Chris from Smile Quilts
chrisrusso_@hotmail.com
- Friday, March 7, 2003 12:16 AM CST
Your almost there sweetie...*BS*....
Love ya
Angel Moo
WV - Thursday, March 6, 2003 1:04 PM CST
Those yuckie IVs but he told them, huh? I feel bad for the kids and the nurses. The nurses really seem to hate doing that. Well, glad you only have ONE more treatment! :) Love, Tracy
Visit Katia's Page and sign her guestbook :)
Tracy
- Wednesday, March 5, 2003 3:44 PM CST
So glad to hear things are going well! I love the new pictures in the album. It's great being able to see the light at the end of the tunnel, isn't it?
God bless,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Sunday, March 2, 2003 2:25 PM CST
Thinking of you and glad things are pretty uneventful for you right now, we just all want to see you feeling so much better. Us too!! Ron has a spinal on March 12th and then we have TWO left! I am happy but apprehensive too, to be finishing. Hugs and prayers,
Chris
~ Gooch's Site ~ ** ** ~ Adopt A Kid's site~ - just click on Caringbridge on the left
- Sunday, March 2, 2003 11:00 AM CST
Hi All! I was so glad to read that things are going so well and what a great trip...there and back...spinal tap and ALL in one day...HOORAY!
Tell ANdrew we said WAY TO GO! He sounds like such a big boy...I bet he is an awesome BIG brother...
Things are going well here...we are looking forward to the day when they kick us out of town :)
In Love & Prayer...Eleasha & Cody & Greg & Riley <codman@cox.net>
www.forcody.org, - Saturday, March 1, 2003 6:11 PM CST
Hello Goodwin Family~
I Just Wanted to Wish You a Great Weekend.
The Anderson Family
- Saturday, March 1, 2003 11:59 AM CST
Hope you are feeling better sweetie..My prayers are with you..Angel Carolyn {Quilts of Love}
Carolyn <carolyn52@ilovejesus.net>
Oklahoma - Friday, February 28, 2003 12:31 AM CST
Hi Aiden just stopped by to say Hi. Hope you liked your quilt. I sure pray it gives you smiles. Take care! hugs Carol
Angel Craving Wings
Winnipeg , Mb Canada - Thursday, February 27, 2003 11:03 PM CST
Hi Aidan,I am Quilting Angel CrochetMa1 and I just stopped by to say hi and to leave you a little gift.
CrochetMa1 <Elite@CrochetMa1.com>
- Thursday, February 27, 2003 4:14 PM CST
My prayers are with Dave & Aidan - I am glad you have joined us at Quilts of Love! hugs Angel Toto
Angel Toto <totoofoz@cox.net>
Lyons, KS USA - Wednesday, February 26, 2003 4:42 PM CST
We will be praying for Dave and for Aidan! Love, Tracy
Visit Katia's Page and sign her guestbook :)
Tracy Solomon
Tampa, - Wednesday, February 26, 2003 3:43 PM CST
Hey guys...hope all is well...we will keep Dave in our prayers...Greg is in the Navy also...but praise God he is on humanitarian orders...for now anyway...
In Love & Prayer...Eleasha & Cody & Greg & Riley <codman@cox.net>
www.forcody.org, - Tuesday, February 25, 2003 9:40 PM CST
Just wanted to drop by and let you all know you are in our thoughts and prayers...
In Love & Prayer...Eleasha & Cody & Greg & Riley <codman@cox.net>
www.forcody.org, - Monday, February 24, 2003 8:47 AM CST
Hi Aidan... Just wanted to stop by to say hello and give you a big hug. I belong to a group of ladies who stitch virtual quilts for children. When you & mom have a moment to spare please stop by Quilts of Love by clicking on the graphic and have a look around. We would love to make you a Quilt of Love of your very own.
Sincerely,
Quilts of Love
Quilting Angel's
Gramma Mimi <grammamimi@quiltsoflove.com>
FL - Saturday, February 22, 2003 9:40 PM CST
Hi! I read that you signed Colton's book! Just wanted to drop by and tell you that your family is in my prayers... also, we have colds too. Hope you guys get better. Colton and family
www.caringbridge.org/ca/coltonmeyer
- Friday, February 21, 2003 7:57 PM CST
AWESOME COUNTS! Love, Tracy
Visit Katia's Page and sign her guestbook :)
Tracy Solomon
Tampa, FL - Friday, February 21, 2003 11:27 AM CST
Just stopping by to say hi and remind you that you all are in our prayers...it was so nice to read the good news about Adian's coutns and know that he is high on the prayer list this next Friday
In Love & Prayer...Eleasha & Cody (www.forcody.org) <codman@cox.net>
- Friday, February 21, 2003 4:12 AM CST
I am sorry to hear that both boys were sick this week---no fun. At least that ANC is up there high enough to fight off the bugs. Wishing you all a good week.
Michelle, mom to Jackson Ben <http://www.caringbridge.com/wi/jacksons.journey>
- Thursday, February 20, 2003 7:18 AM CST
Good news on the counts, whew, I was a little bit worried for him too.
Hopefully everyone will get past these winter bugs and feel better!
Love Kellie
- Wednesday, February 19, 2003 11:35 PM CST
Sorry to hear that everyone is feeling kind of yucky...glad to know your counts are back up :) HOORAY AIDAN!
Things are good here...we were blessed be far enough south that the "big snow" didn't get us too bad...good thing...I had trouble managing 2" let alone 2'
Cody just stood in the doorway and laughed and laughed as I attempted to figure out what to do with the snow after I figured out the best way to shovel it...next time I am opting for a snow blower :)
In Love & Prayer...Eleasha & Cody (www.forcody.org) <codman@cox.net>
- Wednesday, February 19, 2003 11:19 PM CST
What??? Bike riding in February?!? Don't you guys get any snow out there? Tell me your at least wearing a hat and mittens!!!
Way to go Aidan! That's a pretty big step! Tell mom you want more than a quarter though!!!
We're still bundled up in the winters layers...our bikes won't come out of the garage for months!!!
Love Kellie
- Monday, February 17, 2003 10:40 PM CST
Aidan,
Congratulations on learning to ride your bike! That is a big accomplishment, and the exercise will be GREAT for your legs....I know that Vincristine can cause some pretty bad leg pains. Baseball is Ross's first love too and he really hopes to be able to play some this spring. Tell Mom to be sure and add some pictures of you in your baseball uniform to the page!
God bless,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Monday, February 17, 2003 9:46 AM CST
Passing thru to check on you guys! Hope you had a wonderful Valentine's Day!
God Bless
Cheryl <cgmyers@swbell.net>
tulsa, ok usa - Saturday, February 15, 2003 9:14 PM CST
Have a wonderful trip!!! May God wrap His loving arms around you!!!
Angela Thomas <http://www.ChristiThomas.com>
Tiffin, OH USA - Friday, February 14, 2003 7:54 PM CST
AIDAN,
WISHING YOU AND YOUR FAMILY A HAPPY VALENTINES DAY!!!
Chris Ullrich - Bella's Grammy <c_ullrich@msn.com, www.caringbridge.com/page/isabellaledesma>
Hemingford, Ne USA - Friday, February 14, 2003 5:57 PM CST
HAPPY VALENTINES DAY!!!
Hugs and kisses for you all!!!
Kellie
- Friday, February 14, 2003 5:21 PM CST
Hope you have an awesome Valentine's Day that is filled with lots of love.
In Love & Prayer...Eleasha & Cody (www.forcody.org) <codman@cox.net>
- Friday, February 14, 2003 2:02 PM CST
We had a great time on our visit this week. We always enjoy being there. Boy's are growing up fast. Have a good time at the pizza parlor. Love
Dad and Mom
Dave Munro <munros@pacifier.com>
Vancouver, WA - Friday, February 14, 2003 9:55 AM CST
Happy Valentines Day, to the Goodwin family!
The family of Jackson Espeseth
- Friday, February 14, 2003 8:16 AM CST
Cody loved playing T-Ball last year and was quite disappointed when he learned he would not be well enough to play again until next year sometime...but his spirits are really good he had fun rollerblading yesterday for about 10 minutes :)
Sorry to hear about the lower counts...I guess it just that time of year? We will pray for a speedy recovery and lots more neutrophils...
I will check back with you guys again soon...
In Love & Prayer...Eleasha & Cody (www.forcody.org) <codman@cox.net>
- Thursday, February 13, 2003 4:23 PM CST
Greeting's from Camas! Just checkin' in to say hello and let you know we're thinking of you all. Love the picture's too! Can't believe how much the boy's have grown up. The last time we say Aidan he was crawling. Great new's about the Disney trip - be sure to post come pic's. Take care! Love, Sean and Tamara Malone
Tamara Malone <tamaramalone@hotmail.com>
Camas, WA USA - Thursday, February 13, 2003 4:22 PM CST
Hi Aidan,
Just stopping in to invite you to visit Smile Quilts. We would love to make you a virtual on line Smile Quilt all your very own. Just click on the graphic to visit and apply for a Smile Quilt. Praying all goes well for you.
Sprite <sprite@tds.net>
Eckert, Colorado USA - Thursday, February 13, 2003 1:50 AM CST
Hi buddy - just wanted to drop by before I forget and wish you a Happy Valentine's Day!
Know many people are thinking of you that day and every day!
{Us guys can capitalize on Valentines Day too --- candy!!!}
Gooch & Mom
Gooch's Site
- Tueday, February 11, 2003 2:33 PM CST
Just checking in to say hi and let you know you are in our thoughts and prayers...I hope all is well...
In Love & Prayer...Eleasha & Cody <codman@cox.net>
www.forcody.org, - Monday, February 10, 2003 9:09 PM CST
Hi there......
Being a Florida native....I think he would like DisneyWorld better. The parks are awesome. My Seth loved Epcot. He loved to go to Germany and see the train display. He also loved to ride the Monorail around the parks. Emily is 2 and 1/2 and loves the Magic Kingdom and all the rides. She is our thrill seeker. Anyway they have something for everyone. I hope when you go the weather is good because all the hotels on the property have great pools. (can you tell we go there alot) Our favorite hotel is Port Orleans-The French Quarters. Kids tend to like one of the All Star Hotels (they all have kid friendly themes). If you need any in put on the Florida Park just ask us.
You have beautiful boys.
We will keep Aidan in our prayers.
Peace
Ruthie (Seth's mom) www.caringbridge.org/fl/sethlovestrains <Rbunkmann@msn.com>
North Palm Beach, Fl - Sunday, February 9, 2003 2:28 PM CST
Saying hello and sending a big hug! Love, Tracy
Visit Katia's Page and sign her guestbook :)
Tracy Solomon
Tampa, FL - Sunday, February 9, 2003 9:26 AM CST
I have added Aidan to my prayer list today; that he would be freed from any symptoms of his disease.
Man of Faith
Ontario, Canada - Saturday, February 8, 2003 2:08 PM CST
Aidan,
Ugh...those steroids can be tough. Hang in there! I was happy to hear about your wish trip ~ I know you will have a blast! Ross went to Disney World during spring break of '01 and also got to meet the Atlanta Braves while he was there. They have their spring training at Disney's Wide World of Sports complex. If you're a big baseball fan, see if your wish coordinator could work it out. It was great!
Take care,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Thursday, February 6, 2003 11:26 AM CST
Hi I just am stopping by your page for the first time, and boy can I relate. I have a daughter who is on steroids right now too! and the saltier the better for her too! Her name is Amanda and she has ALL as well. Amanda will be done with her treatment in May of this year if all goes well. I'm glad to have found your page! hang in there with those steroids! We also went to Disneyworld for our make a wish, it was truly the most incredible time we have ever had! I am so excited you guys get to go! Have fun!!!!!!!!
Tonya LLoyd <www.caringbridge.org/ut/amanda>
SLC, UT - Monday, February 3, 2003 10:28 PM CST
I stopped by again today---curious as to how your make-a-wish meeting went. I see that your page has the updated look also. I love the poem that you put on here. It is so very true.
Your support has meant a lot to me, and I thank you.
I will keep you in my prayers during the steriods. :) My little boy Joe is just coming off prednisone for a bad cold that he had, and I almost forgot how crazy that all gets.
Wishing you a wonderful week!
Jackson's mom, Michelle
Clear Lake, WI - Monday, February 3, 2003 3:32 PM CST
Hi! I'm glad to hear it went well with Make A Wish, it's great knowing that you all have something to look forward to, and the fact that you can go before December. Yeah!
Have a great week!
love,
Paula
B'ham, WA USA - Monday, February 3, 2003 10:51 AM CST
Hello,
Thank you for 'hitting' Zach's page and supporting the 'club'. It is great to have people out there that believe in each other. I hope that all goes well with the wish. Make the most of it...it is a once in a lifetime.
Your New Cyber friends....
www.caringbridge.org/fl/zacharyfinestone
Scott, Rebecca, and Zachary <srfinestone@hotmail.com>
Jensen Beach, FL USA - Monday, February 3, 2003 7:42 AM CST
Just stopping by to say hi and let you know you are in our prayers...
In Love & Prayer...Eleasha & Cody (www.forcody.org) <codman@cox.net>
Duke University Medial Center, Rm: 5214 - Sunday, February 2, 2003 7:48 PM CST
Elizabeth & family--Just stopping by to say hello.
I am anxious to hear about your Make-A-Wish plans.
Wishing you a wonderful week. With love and prayers.
Michelle
Jackson's mom, Michelle
- Sunday, February 2, 2003 1:37 PM CST
Hi Adian I would love for you and your family to visit our site and see if we could do this for you? love Angel Toto
Toto <totoofoz@cox.net>
Lyons, KS USA - Saturday, February 1, 2003 11:57 PM CST
Just dropping by to say hello :) thanks for signing colton's guestbook....
www.caringbridge.org/ca/coltonmeyer
- Saturday, February 1, 2003 9:06 PM CST
So glad things are going well. Hope the Friday treatments go smoothly. We are so proud of all of you and are looking forward to our visit in a couple of weeks. Our plan is to come on February 11th, weather permitting.. Love. Dad and Mom
Dave Munro <munros@pacifier.com>
Vancouver, WA - Thursday, January 30, 2003 at 09:38 AM (CST)
I think sometimes status quo is the best way to be especially dealing with this stuff...
What verse did Andrew read?
Thanks again for your prayers and support...that really do mean so much...
In Love & Prayer...Eleasha & Cody (www.forcody.org) <codman@cox.net>
Duke University Medial Center, Rm: 5214 - Thursday, January 30, 2003 at 01:24 AM (CST)
Aidan and Family,
Gald to hear everything is going well.
How did the support group turn out? What did you do? We live in a small community, less than 1000 population, so we have not been able to attend any, and would not know what to do or how to start.
Please let us know.
God Bless
Chris Ullrich - Bella's Grammy <c_ullrich@msn.com, www.caringbridge.com/page/isabellaledesma>
Hemingford, Ne USA - Wednesday, January 29, 2003 at 09:51 AM (CST)
Just a quick hello to let you know you are in my prayers. Love, Tracy Solomon
Katia's page
Tracy Solomon
Tampa, FL - Tuesday, January 28, 2003 at 04:25 AM (CST)
You continue to be in my thoughts and prayers. Hope all is well!
God bless,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Monday, January 27, 2003 at 09:02 AM (CST)
Thank You so much for guestbook entry...I know you can probably relate...I just love getting them...anyway...you will have to keep in touch and let us know of Aidan's progress...it would seem you all have been dealing with this stuff nearly as long as we have...Cody was diagnosed on 30Oct1999...it is amazing to me how quickly life can change...I choose to look at our trial as a blessing from God...that victory over it will glorify Him.
In Love & Prayer...Eleasha & Cody <codman@cox.net>
www.forcody.org, - Sunday, January 26, 2003 at 02:15 AM (CST)
You are in our prayers here in NC at Duke...
In Love & Prayer...Eleasha & Cody <codman@cox.net>
www.forcody.org, - Wednesday, January 22, 2003 at 07:55 PM (CST)
Just checking in....hope all is going well!
God bless,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Tuesday, January 21, 2003 at 11:29 AM (CST)
I read your journal faithfully, but somehow on my last trip through, I missed the part about Aidan's Wish, and your support group how did I do that?!? Anyway...I am so happy that Aidan is getting a wish granted!!! Make a Wish is absolutley amazing, but what's up with having to wait until he's five years old!?! I know alot of folks who have made the Disney wish, and you guys are going to have a well deserved BLAST!!! you know what, BLAST just doesn't fit very well here let me change that...a very much deserved, totally needed, VACATION!!! You guys are going to love it!!!! What a wonderful gift to look forward to opening! YEAH Aidan!!!
Elizabeth keep us posted about your support group and GOOD LUCK!!!, Your right, if only one person goes, it'll all be worth it!!! There are a group of us here who have been getting together for over two years now, they have made the difference between just getting through this, and getting through it with a little more strength, a little more faith and alot more smiles! Nothing like surrounding yourself with those who are wearing the same pair of shoes as you!!! The silver lining in what can be a very dark cloud sometimes.
Wishing you continued wellness. take Care, Always in my prayers.
Love Kellie
- Monday, January 20, 2003 at 02:41 PM (CST)
Aidan,
I am glad to hear that things are going well. I know you will enjoy Disney, my Make A Wish trip there was awesome! Take care.
Christamae www.caringbridge.com/ca/oellacz
- Sunday, January 19, 2003 at 07:53 PM (CST)
I am glad to see things are going well. Just stopped by to see if there was any new updates but no news is good news...
Love, Tracy
Katia's page
Tracy Solomon
Tampa, FL - Saturday, January 18, 2003 at 03:40 AM (CST)
so glad to see things are well there. I know the support & prayers from others mean a lot. We will are thinking of you and praying for you.
Chris ~ Gooch's Site
Adopt a Kid's site at www.chubbychica.com
- Friday, January 17, 2003 at 11:30 PM (CST)
Hi Aidan,
You don't know me, but I learned about you from a webpage of a friend (Gooch's mom, Chris). She had the great idea for people to "adopt" kids w/webpages and to sign in and check on them. I look forward to learning more and more about you! I also have a son with ALL. I'll be keeping you in my prayers.
God bless,
Lisa Agee (www.caringbridge.com/page/ross) <lagee67@hotmail.com>
Camden, AL - Wednesday, January 15, 2003 at 04:07 PM (CST)
Our prayers are with you.
Lynn
www.caringbridge.org/pa/jessiespage, PA - Monday, January 13, 2003 at 11:15 AM (CST)
I love Aidan's name! That is very pretty. Where did you get it? I am sure you are happy school is back in. I am glad to hear things are going well. Keep up the good fight!
Love, Tracy Solomon
Katia's mom (http://caringbridge.org/fl/katia_leukemiapage/)
Tracy Solomon
Tampa, FL - Friday, January 10, 2003 at 03:51 AM (CST)
Wishing you all a wonderful New Year. Thank you for the beautiful Christmas Card and the boys look so handsome in their picture. We pray that Aidan continues to do well. We check in every week. Have a great week.
The Anderson's <tandha@amerytel.net>
- Tuesday, January 07, 2003 at 12:15 AM (CST)
Hi All,
We were very excited to receive your Christmas letter. I'm ashamed to say that I was surprised at some of the news but very glad that life is smiling on you all. If you have time, please email us. All our prayers,
John, Lori, Kyle, Ashley,
(oh yes, and one on the way!)
The Hunters <4cougars@sbcglobal.net>
El Dorado Hills, CA USA - Monday, January 06, 2003 at 04:57 PM (CST)
Hi Goodwin Family! We loved your Christmas letter and are so happy to hear that Aidan is doing well! My daily struggles with two small children pale in comparison to yours. You will continue to be in our prayers and hopefully someday our children can meet!
Colleen (Cavanagh) Gurkin <colleengurkin@attbi.com>
Issaquah, WA USA - Monday, January 06, 2003 at 03:38 PM (CST)
Great update. Hope the steroids don't get too much of a negative reaction. Tell Andrew the "Cougs" just needed more spinach in their pre-meal.
Love. Dad
Dave Munro <munros@pacifier.com>
- Monday, January 06, 2003 at 12:06 AM (CST)
Yeah!!! New pictures!!! I see your holding true to you New Years resolution!!!
I wish your family all the best in the New Year!!! It wasn't so long ago when 2003 felt like it was never going to get here, and now here it is, only a couple days away. I know the big day still a long way off, with plenty of obstacles still standing in the way, but at least this is the year that brings the end within our field of view.
As always I keep your family in my prayers and in my heart.
Here's to 2003!!! It's going to be a big one for us!!!
Love Kellie
- Sunday, December 29, 2002 at 10:39 PM (CST)
Glad you had a safe trip home. We had a great time
with you all here. GO COUG'S,
LOVE. DAD
Dave Munro <munros@pacifier.com>
- Sunday, December 29, 2002 at 07:16 PM (CST)
Wishing you a Safe and Happy Holiday Season.
The Anderson Family <tandha@amerytel.net>
- Tuesday, December 24, 2002 at 01:29 PM (CST)
The flu?!?!? Poor Aidan!!!! We all got that last year, despite our vaccine, and it was absolute misery!!!! So glad to hear he's beginning to bounce back!!! These kids of ours...will it ever end?!?! Fall can't get here soon enough!!! I hope he's able to tolerate his med increase, we'll be keeping our fingers crossed for you!!!
Gob Bless!!!
Love Kellie
- Saturday, December 21, 2002 at 09:50 AM (CST)
Wishing you a very Merry Christmas! May your holidays be very blessed.
Special thoughts of Aidan tonight,with his sore mouth. Ouch.
Thank you, as always to you Elizabeth for your kindness to our family, your support, and your encouragement.
Jackson's mom, Michelle <michellee@whiteeaglebuildingsystems.com>
Clear Lake, WI - Friday, December 20, 2002 at 04:57 PM (CST)
Merry Christmas!
And prayers to get rid of that "hacking". Also prayers for Grandma!
Hugs
Cheryl <cgmyers@swbell.net>
tulsa, ok usa - Thursday, December 19, 2002 at 02:18 PM (CST)
Before when I signed in, I knew I had been to your page because I had you in my bookmarks. I couldn't remember for sure if I had signed in and at the time I didn't have time to go all the way back through your guestbook. Well, tonight I made the time to and realized that I haven't signed in before. I apologize for that but I have kept up with your story periodically and will try to do so more often. Blessings to you and you will be in my thoughts and prayers as the Lord leads! Merry Christmas if I don't get back before then.
Khalita www.caringbridge.com/nc/khalita Duke Peds BMT aplastic anemia <khalita@hecaresonline.org>
Lexington, NC - Tuesday, December 17, 2002 at 08:04 PM (CST)
Aidan, I just wanted to wish you a FANTASTIC HOLIDAY AND MUCH HEALTH & HAPPINESS!
Gooch & Mom
Gooch's Site
- Tuesday, December 17, 2002 at 06:51 PM (CST)
Way to go Aidan. We are proud of you. We look forward to seeing all of you over Christmas v acation.
Love
Mom and Dad
Dave Munro <munros@pacifier.com>
- Monday, December 09, 2002 at 11:30 PM (CST)
Is there a special little boy having a birthday ??
I sure hope that it is a fun day!
4 years old is very big. :)
Happy Birthday Aidan.
Love, The Espeseth family
Jackson's mom, Michelle
Clear Lake, WI - Saturday, December 07, 2002 at 09:26 AM (CST)
We had a great time with all of you over Thanksgiving.
The drive to the river was slick with freezing fog and black ice. A few cars and trucks off the road but we kept it slow and had to problems. Hope everything goes well in Redmond this week. Keep us posted.
Love. Dad and Mom
Dave Munro <munros@pacifier.com>
Vancouver, WA USA - Monday, December 02, 2002 at 10:49 PM (CST)
Hope you had a wonderful Thanksgiving... praying that all goes well in the life of your child... Laura and her sons
www.caringbridge.org/ca/coltonmeyer
- Friday, November 29, 2002 at 09:06 PM (CST)
Hoping you all had a beautiful Thanksgiving!!!
Love Kellie
- Thursday, November 28, 2002 at 09:12 PM (CST)
Happy Thanksgiving to the Goodwin Family!
Many blessings to you always. :)
M.Espeseth family <http://www.caringbridge.com/wi/jacksons.journey>
- Wednesday, November 27, 2002 at 01:38 PM (CST)
Just wanted to wish you a Healthy & Happy Thanksgiving
chris
Gooch's Site
- Wednesday, November 27, 2002 at 01:08 PM (CST)
Just wanted to stop by and say....
HAPPY TURKEY DAY!!!!!
Love
Cheryl <cgmyers@swbell.net>
tulsa, ok usa - Wednesday, November 27, 2002 at 11:56 AM (CST)
Glad to hear those counts came up!
Not much time now, just wanted to stop by and say HI!
chris
Gooch's Site
- Sunday, November 24, 2002 at 10:15 PM (CST)
Just a note to let you know that I stopped by, and that I think of you daily. Many blessings!
Michelle E. <eaglet@cltcomm.net>
Clear Lake, WI - Friday, November 22, 2002 at 07:19 AM (CST)
We are looking forward to spending Thanksgiving
with you. GO HUSKIES.. Love
Dad
Dave Munro <munros@pacifier.com>
- Wednesday, November 20, 2002 at 11:26 PM (CST)
I haven't written in a while, but I visit here often and your in my thoughts and prayers always!!!
Wishing you well at your appointment today! I sure can appreciate Aidan's hesitation (thats putting it lightly huh?) with the new method of blood draws and infusions!!! After having spent the past two years adapting to this new life, it suddenly becomes diferent, unpredictable and uncertain, and to throw in IV needles and finger pokes no less!!! Hang in there!!! It took Sammy a long time, and I mean LONG time, to adapt to all the pokes, even with EMLA, but now it's smooth sailing.
Good Luck today!!! We'll be thinking of you!!!
Love Kellie
- Wednesday, November 20, 2002 at 08:47 AM (CST)
Just flying thru to see that everything is ok! Hope that your counts are great Wednesday.
Take care and HUGS!!!!
Cheryl <cgmyers@swbell.net>
tulsa, ok usa - Tuesday, November 19, 2002 at 09:40 PM (CST)
I am just getting back online from when we moved. We are still not fully settled in and unpacked. I am really sorry to hear of those repeated blood tests - thats ridiculous. We had BC and had to switch to Connecticare - we had too many hassles and headaches with Blue Cross. I wish none of us had to deal with the insurance hassles on top of everything else....
chris
Gooch's Site
<chrisrusso_@hotmail.com>
- Saturday, November 16, 2002 at 08:46 PM (CST)
Wow. A tough couple of days. Lots to think about but you will make the right choice for Aidan. Have you talked to Aidan about the options? Hang in there.
Love.
Dad
Dave Munro <munros@pacifier.com>
Vancouver, WA - Friday, November 08, 2002 at 11:39 PM (CST)
I don't think i've signed in here in quite some time. I have not forgotten about you though. i will continue to keep you guys in my thoughts and prayers. blessings!
khalita www.caringbridge.com/nc/khalita Duke Peds BMT Aplastic Anemia <khalita@hecaresonline.org>
Lexington, NC - Friday, November 08, 2002 at 08:30 PM (CST)
Glad you're enjoying the freedom of being without the line, though getting sticked is not easy for anyone, including grown ups! Hope Aidan does well. Tell him I have some goodies for him that he can pick up when you head to the right side of the state for Thanksgiving!!! Love to all!
Nikki Nadig
Vancouver, - Thursday, November 07, 2002 at 10:06 PM (CST)
Glad to hear your concerns are being addressed. Be patient but vigilant. Tell Aidan that he can handle next Friday. He is such a tough little guy and has been
through a lot (all of you have). See you Thanksgiving.
Love. Dad
Dave Munro <munros@pacifier.com>
- Thursday, October 31, 2002 at 03:55 PM (CST)
Just stopped to say BOO and HAPPY HALLOWEEN Goodwins!!!
We have an interesting evening planned...It's so cold here in MN that we are taking Harry Potter and Dorothy trick-r-treating inside at the mall...Can you believe that?!? What a silly way to collect candy and treats. In all my years of living here, this'll be our first indoor halloween!!!
Hope you and all the other little ghosts and goblins have fun tonite!!!
As always, in out thoughts and prayers!!!
Take Care
Love Kellie
- Thursday, October 31, 2002 at 11:50 AM (CST)
Happy Halloween Aidan & Andrew!!
The Anderson's
Clayton, WI - Thursday, October 31, 2002 at 09:49 AM (CST)
Dontcha just love it when your questions regarding your childs (and countless others') health is a nuisance to them? Keep at it, they will never disclose anything willingly.
chris
Gooch's Site
- Friday, October 25, 2002 at 10:21 PM (CDT)
Hey there! Have a wonderful holiday season, Laura
www.caringbridge.org/ca/coltonmeyer
- Tuesday, October 22, 2002 at 03:29 PM (CDT)
Good Morning!
It's been awhile since I've posted but I always check on ya! Good going on not having the line anymore. And hopefully he won't have to have it reinserted.
Hugs to all!
Cheryl <cgmyers@swbell.net>
Tulsa, OK OuterSpace - Monday, October 21, 2002 at 10:04 AM (CDT)
Hi there, hope you are doing well. I am enjoying missing school but if my counts go up will have to go back eventually! Since we are moving then & wont have computer for 2-3 days, I wanted to wish you a HAPPY HALLOWEEN! 
Gooch
Gooch's Site
- Saturday, October 19, 2002 at 12:19 AM (CDT)
Happy to hear that Aidan is home again and things went well. We are thinking of you and your family.
Heather & family
- Thursday, October 17, 2002 at 09:51 AM (CDT)
We had a good drive back and just reviewed your Journal writings. We were so happy we could be there to help out. Aidan looked great when he came home and I know Andrew was excited to see him. We love you all. Dad
Dave Munro <munros@pacifier.com>
- Sunday, October 13, 2002 at 10:39 PM (CDT)
So glad to read that everyone is home together safe and sound!!! Too much activity for one weekend huh?!?! Thank goodness none of the Vinc infiltrarted into the surrounding tissue!!! SCAREY!!! Your prayers were certainly heard, and answered!!!
So no line for a while?!? Wow---a nice little vacation for you!!! Enjoy!!! Alot for poor little Aidan to digest I'm sure. Bathtime will develope somewhat of a new routine, and I'd say hit those pools while the hittin is good!!! Maybe instead of replacing the hickman, you can give a port a try, ours has been good to us!
Anyway, take care Goodwins!!! So glad to hear everything turned out well!!!
Get some Rest!!!
Kellie
- Sunday, October 13, 2002 at 07:58 PM (CDT)
Phew! Glad that lovely boy is doing well! Hang in there Aidan's parents. We love you.
From the Nadig Family (still hoping you'll move in to that house next door that is for sale - just think how much fun those little cousins could have!)
Nikki Nadig
Vancouver, WA USA - Sunday, October 13, 2002 at 12:14 PM (CDT)
Ooooh, glad to hear they got it out okay and found out about it right away!
chris
Gooch's Site
- Sunday, October 13, 2002 at 09:18 AM (CDT)
I am so happy to hear that the line removal went well. Their little veins go through so much. I am sure that it will heal well, and that the next line placement surgery will go well also. Wishing you a relaxing day after all of this.
Jackson's mom, Michelle
Clear Lake, Wi - Sunday, October 13, 2002 at 08:56 AM (CDT)
Thank you, Jesus! What a scare. Continued prayers...
Brenda Snell <bksnell@pacifier.com>
Camas, WA Clark - Saturday, October 12, 2002 at 11:19 PM (CDT)
Katherine is blowing kisses to Aidan, Andrew, Mike, and "Libeth." She says "here they come!" We love you. Katherine, Scott, Katrina
Katherine
- Saturday, October 12, 2002 at 03:30 PM (CDT)
I am sorry to hear you that aidan is having problems with his port. He is in my prayers.
Theresa <blessingstimes3@webtv.net>
balto, md balto - Friday, October 11, 2002 at 09:12 PM (CDT)
Oh man you guys, I am sorry you are having port trouble.
I guess they will replace it when they remove it huh?
Hope all goes well, I am sure it will!
chris
Gooch's Site
- Friday, October 11, 2002 at 08:15 PM (CDT)
Prayers, love and best wishes.
Cheryl <mmgal_martin@yahoo.com>
Tulsa, OK USA - Friday, October 11, 2002 at 06:17 PM (CDT)
Dear Goodwins,
Please know that we are praying for all of you during this stressful time with Aidan's line. He has done so well with everything else, I'm sure this will be the same. We love you guys.
Sandy Otis
- Friday, October 11, 2002 at 05:39 PM (CDT)
Aidan and family you are in our prayers. Our thoughts are positive ones and we hope all goes smoothly in Redmond. All our love and prayers.
Love, Heather & family
Heather & family
Clayton, WI - Friday, October 11, 2002 at 04:18 PM (CDT)
Hello,
I will pray for you today and add you to our CB list of children we pray for! God Bless you all!
Lynn www.caringbridge.com/pa/jessiespage
PA - Friday, October 11, 2002 at 04:01 PM (CDT)
We send our love to all of you. We're very sorry to hear about Aidan's line. We'll be thinking about you as you head to Redmond.
Love, Katrina, Scott, and Katherine
Katrina
- Friday, October 11, 2002 at 04:00 PM (CDT)
Just stopping by to say hello...and let you know that we are thinking about you!
Jackson's mom, Michelle
- Sunday, October 06, 2002 at 07:37 PM (CDT)
Way to go Aidan. Glad you are back to a normal schedule. See you next Thursday. Love
Dad
Dave Munro <munros@pacifier.com>
- Thursday, October 03, 2002 at 12:27 AM (CDT)
I am glad his counts rebounded so fast, you must be relieved. Well I just wanted to check in before bed so... have a good night!
chris
Gooch's Site
- Thursday, October 03, 2002 at 12:00 AM (CDT)
Hi Aidan,
I hope your counts are improving and that cold is going away!
Love,
Zackie (Dx JMML 5/01, BMT 10/04/01)
Dana
Zachary's web link
- Tuesday, October 01, 2002 at 01:23 PM (CDT)
Oh Hunny!!! I wish I was closer to you, I'd march right over there with a great big hug, mom to mom!!!
It's funny, I too have been feeling very "sick of this" lately!!! Very tired of our cancer lives!
How do you not? We must allow ourselves to go down that road every now and then, to let our hearts grow weary, as long as we don't spend too much time there, and are able to find our way back again.
Three years and two months...no matter how you look at it, its a mighty long time!!! Adjusting to this new normal does not come naturally (even after two long years), it requires alot of patience, endless strength, and persistant maintenance.
One year to go, there is a light at the end of the tunnel!!! If there is ever anything I can do to to help your shine a little brighter, just let me know. Everybody's flickers once in a while, it's all part of the journey.
Hang in there!!! You'll get there!!!
PS. I know there is alot of viral stuff going around here in MN, lots of low counts in our clinic these days. It can defiantely make for a long hard winter!!!
Love Kellie
- Friday, September 27, 2002 at 11:33 PM (CDT)
Elizabeth---I just stopped by to check on you all. I am sorry that Aidan's line is having issues. It seems like there is always something....like treatment isn't enough. :) I pray that you get some relief with the insurance issue also!
Wishing you a blessed weekend.
Michelle
Jackson's mom, Michelle
- Friday, September 27, 2002 at 02:07 PM (CDT)
Oh man, I feel for you guys. It absolutely stinks to need to be concerned with the bills on top of all this. I hate to tell you this, but do you realize the L & L Society has a maximum of $500 a year per family? I found that out fast...
chris
Gooch's Site
- Thursday, September 26, 2002 at 10:11 PM (CDT)
Hi!
Just checking in to see how you are doing! Enjoy the game!
Hugs
Cheryl <mmgal_martin@yahoo.com>
Tulsa, OK USA - Tuesday, September 24, 2002 at 04:30 PM (CDT)
We will see you in Seattle tonight. Too bad you had to settle on Mariner tickets instead of the Husky/Wyoming game!!!! I was thinking of buying breakfast for all of us on Saturday morning but may pass on Aidan if he is eating that much/ Love. Dad
Dave Munro <munros@pacifier.com>
- Friday, September 20, 2002 at 09:31 AM (CDT)
Thank you for the recent information. I sent away for gold ribbons. We will wear them and think of you all. Have a great time at the game! It is cool up there. Andrew reminds me of my brother when he was little. He would search the stats and to this day can still recite numbers from various players. It was unbelievable. You are all in our prayers and thoughts. If there is ever the possibility, we would sure love to get together with you guys soon. Much love
Brenda <bksnell@pacifier.com>
Camas, WA US - Friday, September 20, 2002 at 12:57 AM (CDT)
Yeah good news!!!! So glad to hear Aidan's counts have sustained themselves and he's been healthy!!! Hope Andrew stays on the road to recovery and keeps the rest of you there with him!!! No fun missing so many days of school especially so close to the beginning of the year.
I hope you guys have a GREAT weekend!!! Sounds like it's going to be a blast. I gotta hand it to you guys, you sure do a good job of keeping yourselves entertained!!! So important to us all! Thank goodness your able to take advantage of outings like this. Remember the days of HEPA masks, and every outing was count dependant?!? Sometimes it feels like yesterday.
So glad to hear that everything is going well!
Always in my thoughts and prayers!!!
Love Kellie
- Thursday, September 19, 2002 at 10:04 PM (CDT)
Hey! Glad to hear good news about the line. I sure would like IVIG with no side effects--is there a secret to that? DO TELL!! Anyways, just wanted to leave a note to make you smile. I hope I did. You're cared for and prayed for! I'll be back to check on you!
Khalita www.caringbridge.com/nc/khalita Duke Peds BMT aplastic anemia <khalita.jones@duke.edu>
Lexington, NC - Sunday, September 15, 2002 at 01:08 PM (CDT)
Glad to hear you are all doing well, and that Aidan is liking school. Ron thinks it cuts into his cartoon network time too much!
Chris
Gooch's Site
<chrisrusso_@hotmail.com>
- Sunday, September 08, 2002 at 11:21 PM (CDT)
Hello Goodwin Family,
I hope that Aidan is doing better and was able to go to preschool this week. I bet he was so excited to go. It is always a fun time for kids. I am sure that Andrew was happy to go back to school and be with all his friends.
We pray that Aidan continues to do well and will be able to go to preschool and make new little friends.
Have a great weekend.
Heather & family
- Thursday, September 05, 2002 at 08:22 AM (CDT)
Just checking in to see how you guys are doing!
Glad to see that everyone is doing well. Insurance companies are just plain evil. :(
Take care and hugs to all.
Cheryl <mmgal_martin@yahoo.com>
Tulsa, OK USA - Saturday, August 31, 2002 at 03:30 PM (CDT)
I am so glad you are all well. Except for the headache of insurance problems - you really need that at a time like this, dont you? We just passed our 2 year mark since diagnosis, and I never thougth we would make it this far. I really took it as an immediate death sentence when they told us. My whole family is gone, so except for 2 older brothers who live at least an hour away each, we had no support & having so much cancer in our families terrifed me. But there is a light at the end. I am glad you guys are finding it. Oh and I think your friend Paula knows you would have done the same for her...
Chris
Gooch's Site
<chrisrusso_@hotmail.com>
- Saturday, August 31, 2002 at 02:57 PM (CDT)
Dear Goodwins,
Happy Anniversary!?!?! It always feels a little awkward to say that to a cancer family on the date of their childs diagnosis, however, it's much too big a day to let go by unnoticed, so not so much happy anniversary, but Congratulations to you all on how far you've come in the during the past two years. I know this date probably comes filled with emotion for you, remembering so clearly everything you were all doing two years ago today, sitting in the waiting room while Aidan had his hickman installed, the first drip of chemo that went into his sweet little body, all the tears, the unrivaled exhaustion that took over during those first couple of months, and wondering every second how any of you were going to get through the next three years, especially your little baby! But here you are two years later, more than half way through your journey, and look at all you've picked up along the way. I know that it hasn't come without it's obstacles, just when you've reached a smooth and uneventful valley, someone throws another mountain in your path and you once again have to find a way to get over it together, and in one piece, wondering how your ever going to carry Aidan over that hill, but you realize on your way up, your not carrying him, he's carrying you. If there's one thing I've learned about living in this world of childhood cancer, it's that the children are the ones who provide the rest of us with the strength to keep on living here. Their enormous hearts and deep spirits somehow make it all manageable.
A little more than a year to go, I'm so glad I have "found" you to walk the rest of our journey with.
Extra hugs to Aidan (and you) today!!! Do something special with yourselves, and here's to climbable mountains!!!!
God Bless you all
Love Kellie
- Saturday, August 31, 2002 at 09:44 AM (CDT)
Elizabeth---I just stopped by to say hello and to check on Aidan. I know that the 2 year mark brings back many emotions. I am sure that it seems like yesterday in many ways, and yet the battle and the treatment schedule can seem endless. You are all doing such a wonderful job and are an inspiration to many. Your sweet boy is a survivor! What an awesome testimony. :)
Many blessings to you all.
Love, The Espeseth family
Michelle E.
- Friday, August 30, 2002 at 08:19 PM (CDT)
Elizabeth & Family,
I just wanted to let you know that I was thinking of you on this anniversary day. How wonderful that Aidan is doing well and fighting this awful Cancer. God is good. We will continue to keep you and your family in our prayers. I hope that Andrew had a fun first week of school.
Heather & family <tandha@amerytel.net>
- Friday, August 30, 2002 at 12:23 AM (CDT)
Hugs!
Hope everything is going great!
Cheryl <mmgal__martin@yahoo.com>
Tulsa, OK USA - Thursday, August 29, 2002 at 03:51 PM (CDT)
Glad to hear that Aidan is doing good. I hope and pray that everything with his port will work out. Glad they had fun at the fair.
Hugs and Prayers,
Dawn Gresham (Tommy's Mom) <bdmtg@hotmail.com >
Warrenville, SC - Friday, August 23, 2002 at 02:13 PM (CDT)
Hope everything works out OK. Glad the boys had such a good time at the fair. Keep us posted. We are slowly getting things together to leave early Tuesday morning. We will call before then. Love
Dad
Dave Munro <munros@pacifier.com>
Vancouver, WA - Friday, August 23, 2002 at 11:26 AM (CDT)
Oh No!!!!!
I hope everything with Aidan's line turns out to be NOTHING!!! I'll say extra prayers for him, and you! So you jump over one hurdle with the good counts and come head on with another one with his line. Hang in there guys, there's bound to be some smooth sailing ahead, right?!?!?
Is Aidan going ot pre-school this year? it must be right around the corner!
Always in my thoughts---
Kellie
- Friday, August 23, 2002 at 10:17 AM (CDT)
YEAH Aidan!!!
Keep up those good strong numbers!!!!
love Kellie
- Tuesday, August 20, 2002 at 11:06 PM (CDT)
Oh great news Elizabeth! I am so happy all is well there.
I know, my little man is starting kindergarten & I am not happy about the idea!
Chris
Gooch's Site
<Chrisrusso_@hotmail.com >
- Saturday, August 17, 2002 at 05:57 AM (CDT)
HI!
Sounds like you had a wonderful time on your vacation! : ) Also sounds like it's time for the shopping list because of the steriods! LOL
Take care!
Cheryl <mmgal_martin@yahoo.com>
Tulsa`, OK USA - Wednesday, August 14, 2002 at 10:21 AM (CDT)
Elizabeth & Family---Happy to hear that you all had a enjoyable family vacation. I am sure that your time away together, from all of the daily schedules and appointments was well needed :) Just stopped by to say hello and let you know that we are thinking of you all. God bless.
Michelle E.
Clear Lake, Wi - Monday, August 12, 2002 at 08:53 PM (CDT)
Glad you had such a great time at S.R. We were also there from the 3rd through the 10th. I almost rode my bike over to Mike's folks' place, but just didn't remember. How nice it would have been to have seen you all. Glad to hear things are going well.
Ruth
Ruth Vesber <rvesber@mac.com>
Vancouver, WA USA - Monday, August 12, 2002 at 05:29 PM (CDT)
We are glad that you had such a great time at Sun River.WE are headed to Bellingham on Thursday. Just had dinner and birthday (mom's) at Scott and Katrina's. Went to the park with Katherine as well. Love.
Dad
Dave Munro <munros@pacifier.com>
Vancouver, WA - Sunday, August 11, 2002 at 11:19 PM (CDT)
Hello...I just wanted to say a big hello from Smile Quilts. We are a group of ladies who stitch virtual quilts for children. When you have a moment to spare please stop by Smile Quilts and have a look around. We would love to make your child a Smile Quilt of their very own.
Sincerely,
The Quilting Angel's
Quilting Angel Island Princess <mooks@bellsouth.net>
- Sunday, August 11, 2002 at 10:29 PM (CDT)
Aidean,
Just checking in on you! Hope that you are having a great time.
Cheryl <mmgal_martin@yahoo.com>
Tulsa, OK USA - Sunday, August 11, 2002 at 04:59 PM (CDT)
Hope you guys have a wonderful vacation!!! Glad to hear that Aidean is doing good. Even if he is being a little stinker.
Hugs and Prayers,
Dawn Gresham (ALL-Kids Tommy's Mom) <bdmtg@hotmail.com >
Warrenville, SC - Friday, August 09, 2002 at 01:40 PM (CDT)
Hope you guys had a wonderful time on your little "get-a-way". I am envious of your ablility to just pack up the car and be in Oregon, or Seattle, or anywhere else out there in just a few short hours, it is so absolutley beautiful!!!
Take Care! Always sending warm thoughts your way!
Love Kellie
- Friday, August 09, 2002 at 09:40 AM (CDT)
Dear Elizabeth,
Let me tell ya, I can totally relate to the words in your last paragraph!!! You are not alone! I too go through all those same thoughts and feelings. Good days are WONDERFUL but never allow you to move too far away from the path that your on, there never seems to be enough time to forget about it all, and often it seems that every one else does. They see the kids looking and feeling good and wonder what it is that we still have to worry about, to fear, to be sad about. We have been blessed with many wonderfully, healthy days, but there are times when our hearts still break. When we look down that road to the completion of therapy, it's still a long time coming. Alot can happen between now and then, and will happen; fevers, extra trips to the hospital, IV antibiotics, infections, you name it...you know that list is endless! Our journies are far from over and it's o-kay to let your heart get a little bit heavy at times, especially with an approaching anniversary---those always seem to be tough days, but hang in there!!! And always feel free to e-mail me if you ever want to "talk"!
Take Care and God Bless!
Kellie Nelson
- Saturday, July 27, 2002 at 08:27 PM (CDT)
We are glad the swimming went well. What a great activity for both boys. Hope you enjoy the boat races. We look forward to seeing you Sunday afternoon.
GO MARINERS. Love. Dad
Dave Munro
Vancouver, WA - Saturday, July 27, 2002 at 02:00 PM (CDT)
Just stopping by to say hi...we think about you every day. Our prayers are always with you all...and hoping that the meds go well. Especially the steroids. :) I am interested to hear about the local meeting with the other leukemia cases....please let me know when you have time. Take care.
The family of Jackson Espeseth http://www.caringbridge.com/wi/jacksons.journey
Clear Lake, Wi - Tuesday, July 23, 2002 at 10:19 AM (CDT)
Howdy!
Just checking back to see that you are doing good. Keep up the good work!!! My crazy animals are doing good!
Cheryl
Tulsa, OK USA - Monday, July 22, 2002 at 05:00 PM (CDT)
Hey Aidan!
Hope everything is going good for you! Do you like animals? I've got some crazy ones here! My little dog named Eisa has decided she likes to do exercises. She was trying to do situps with my daughter! She was laying on her back while my daughter did sits ups! Crazy crazy dog! I have a Japanese Goldfish that sleeps UPSIDE down!!! Is that silly or what? We can poke him in the belly when he's asleep! Take care and I will write more later!
Cheryl
Tulsa, OK USA - Wednesday, July 17, 2002 at 11:14 AM (CDT)
HEY I JUST WANTED TO SAY BE STRONG AND KNOW THAT THE LORD IS WITH YOU AND YOUR FAMILY!! GOD BLESS YOU!!
JENNIFER OSTEEN <JENNIFER738@AOL.COM>
RIPLEY, TN - Tuesday, July 16, 2002 at 12:10 PM (CDT)
Hi Aidan!!! I found your address on another caringbridge site. I wanted to tell you that you are an adorable little boy. Sending you some hugs, smiles, and sunshine!!!!! :) :) :) :)
Rae <rfbocritter@yahoo.com>
Tulsa, OK - Monday, July 15, 2002 at 03:18 PM (CDT)
Dear Goodwins,
Heard via Menzias that you enjoyed the Reverand Billy. Matt and I wish we could have been there. Take care, Laura, Matt, Thomas and James
Laura McDonagh <mcdonaghmatt_laura@hotmail.com>
Nampa, ID USA - Saturday, July 13, 2002 at 04:44 PM (CDT)
Dear Elizabeth,
Sounds like you guys have been having a great summer, definately staying busy. I'm so glad you were able to spend some time with your families---grandma's and grandpa's are the best!!! My mom's side just had their annual summer get-together (in Moses Lake) We sat this one out, just not ready to load Sammy up on air plane and take him so far away from his doctor (we're still working on our comfort level) but when we were considering the trip, looking you up would have certainly been on my itinerary. It would be so neat to meet you guys!!! There's always next year!!!
Have a GREAT week! hopefully those counts wil shape up!
Love Kellie <sonofanelson@aol.com>
- Saturday, July 13, 2002 at 10:07 AM (CDT)
Thinking of you a lot these days. Enjoyed the recent photos. You are amazing. Continued prayers...
Brenda Snell <bksnell@pacifier.com>
Camas, WA Clark - Friday, July 12, 2002 at 05:23 PM (CDT)
Glad to hear all sounds fine on your end.
You just reminded me our VBS starts next week as well!!!
Chris & Gooch
Gooch’s Page
<chrisrusso_@hotmail.com>
- Friday, July 12, 2002 at 11:36 AM (CDT)
Only in the 90's here but that is hot enough for us. Next week is Relay for Life weekend for us. Also a wedding for Cale Piland. Glad you had a great time when you were here. We enjoyed seeing all of you. Spent most of yesterday with Katherine. Love, Dad
Dave Munro <munros@pacifier.com>
- Friday, July 12, 2002 at 09:51 AM (CDT)
Hi Goodwins. I ran into your folks at Barnes and Noble on Sat. Elizabeth. They gave me the web address, so here I am. I'm so glad to hear you are all moving down the road with Aidan progressing with his treatment. It's so good to know we don't have to go it alone. I'll write more later as I have to send you a letter from a former student - Ravio kid I believe. He is so appreciative of your wonderful teaching for him. We knew that already didn't we?:)
Take care and have a good fourth.
Ruth
ruth vesber <rvesber@mac.com>
vancouver, wa usa - Monday, July 01, 2002 at 11:14 AM (CDT)
Happy {and HEALTHY} 4th of July you guys. Be safe!
Chris & Gooch
Gooch’s Page
<chrisrusso_@hotmail.com>
- Sunday, June 30, 2002 at 04:28 PM (CDT)
It won't be long and Aidan will be liking the water also. We look forward to seeing you the 6th.
Dad
Dave Munro <munros@pacifier.com>
- Saturday, June 29, 2002 at 01:28 PM (CDT)
Hello Goodwin Family,
Thank you ,Elizabeth for the wonderful letter and photos. You have a great family and a dear heart. You have a busy schedule and you seem to have a good balance of it all. It was good to hear that your parents were visiting. It is always such a special time for kids to be with their Grandparents. Grandparents need it too. I hope that your week goes well and Aidan continues to do good. Andrew is such a active little man. How fun, to play soccer and go swimming and get to spend the weekend with his grandparents all to himself. Enjoy the week.Take care.
Heather <tandha@amerytel.net>
- Tuesday, June 25, 2002 at 10:12 PM (CDT)
Just checked in on the website. We got home about
2:30 with a nice drive down the Washington side. We
stopped at the new Maryhill winery and bought some
wine and then stopped in Stevenson at the Big River
Grill , which we like very much, for lunch.
Had a great time visiting with all of you and we were glad we could spend some quality time with the boys.
You are great parents and we think tthe boy"s are doing so well. See you on the 6th. Tell Mike I am working on the golf. Be sure bathing suits come with the boys.
A great swim lesson Andrew.
Love. Dad
Dave Munro <munros@pacifier.com>
- Monday, June 24, 2002 at 05:43 PM (CDT)
WOW---full dose chemo! Who would have ever thought huh? Hopefully Aidans counts will hold strong for you this week, and of course maintain themselves for the increase! Just in time for summer too--It's nice to have everything sort of fall into place this time of year!
Hope everything continues to go well for you guys---and a happy late fathers day wish to your hubby!
Take care you guys!
Kellie <sonofanelson@aol.com>
- Monday, June 17, 2002 at 09:05 AM (CDT)
What great news. Happy Fathers Day. See you on Thursday mid-day. Grandma is anxious to talk to DAWG. We love you.
Dad
Dave Munro <munros@pacifier.com>
- Sunday, June 16, 2002 at 11:16 PM (CDT)
Hi guys, I am so glad his counts are good!!!
hope you guys are all doing well and enjoying the weekend
and a HAPPY FATHER'S DAY to you know who!
Chris & Gooch
Gooch’s Page
<chrisrusso_@hotmail.com>
- Friday, June 14, 2002 at 11:42 PM (CDT)
Hello from Camas! We're glad to hear Aidan's count's are good and all is well with everyone. Your all in our thought's & prayers.
God Bless, Sean & Tamara Malone
Tamara Malone <tamaramalone@hotmail.com>
Camas, Wa USA - Thursday, June 13, 2002 at 02:59 PM (CDT)
Hi guys
glad to hear things are moving right along and you'll be back at 100% dose soon!
Potty training - gotta love those days - I am SO glad thats behind me!
Although a refresher course in "AIM" might be needed around here!
Chris & Gooch
Gooch’s Page
<chrisrusso_@hotmail.com>
- Saturday, June 08, 2002 at 07:41 PM (CDT)
Way to go on those counts Aidan!!!
Kellie <sonofanelson@aol.com>
- Saturday, June 08, 2002 at 10:59 AM (CDT)
Aidan,keep up the good work on potty training. That is always fun...We are happy to hear that you are continuing to make progress with the treatment and your counts are good.
Andrew enjoy your last week of school. How lucky to get to go to a Mariners game. Enjoy the game ...
We hope that you have a wonderful weekend.
God Bless..
Heather Anderson & family <tandha@amerytel.net>
- Friday, June 07, 2002 at 10:30 PM (CDT)
So happy things are going well with the treatment.
We remember 3 1/2. Have a great last week at school Andrew. Katherine is two tomorrow and we go to Chucky Cheese.
Dave and Sue Munro <munros@pacifier.com>
- Friday, June 07, 2002 at 09:51 PM (CDT)
Way to go Aidan, we are so proud of you. We will see you all in a couple of weeks when Andrew is a lst grader. Love
Gram and Gramps
Dave Munro <munros@pacifier.com>
- Wednesday, June 05, 2002 at 09:15 AM (CDT)
It is great to hear that everything is going well. Aidan is doing good. Andrew is busy as always. We loved the relay pictures.What an awesome experience that must be.
It was so very special of you to walk in honor(Memory) of our precious nephew Jackson Ben. He is so special. His story has touched so many people. Taught us all so much.
Thank you for continuing to pray for all of our family. Your kindness and love is so wonderful.
We continue to keep Aidan and his wonderful family in our prayers always.
Heather Anderson & family <tandha@amerytel.net>
- Monday, June 03, 2002 at 10:28 PM (CDT)
My three year old nephew has just been diagnosed with acute leukemia.Im beside myself. What can I do to help??
CelesteZaffarano <ceezee59@hotmail.com>
clinton twp., mi. macomb - Monday, June 03, 2002 at 07:36 PM (CDT)
Hello Goodwin gang---
The relay pictures are great!!! Thats an event that I hope to participate in some day, I've heard over and over again what an amazing experience it is, never walked it, but I made a luminary for my Sammy just last week, wish I could hear his name being read off.
Sounds like all is well with you guys and you are enjoying your summer! We are finally seeing ours, it's been an awefully chilly spring here, but we're making up for it now, the flowers are finally working themselves into bloom, I love this time of year!!! Wishing you all a beutiful, healthy and "uneventful" summer.
---just wondering---has Aidan ever had a neutrophil antibody test done?
Take Care!!!
Kellie
Kellie Nelson <sonofanelson@aol.com>
Big Lake, MN - Friday, May 31, 2002 at 09:03 AM (CDT)
Hey Goodwins,
I love the Relay for Life pictures. I'm bad I still haven't gotten ours developed yet. But as sure as I do I'll put them on Tommy's website. Hope that Aidan continues to feel better. Enjoy seeing your family.
Hugs and Prayers,
Dawn Gresham (Tommy's Mom ALL-Kids) <bdmtg@hotmail.com (**www.caringbridge.com/sc/tommygresham**)>
Warrenville, SC - Thursday, May 30, 2002 at 01:02 PM (CDT)
Hey Goodwins
I want you to know how lucky you are to have a doctor like that - we have 11 kids in my area and the CDC told me to report it to my town health dept so they could "track the trend". That was 11/2000 - havent gotten even a phone call yet in 2 years! and this is a small town. Wrote to WEED, ASDTR, State Atty General, State DEP - you name it - got as far as an epidemiologist who did not seem too optimistic with defining us a cluster and being able to blame it on the company 2miles away that exceeded the govt safe level of TCE emissions by 300% the year prior to all the diagnoses... I would kill to get a doctor as invloved as yours is!!!! I hate to use his page for this but it may help prompt other families to look into something...
Chris
Gooch’s Page
<chrisrusso_@hotmail.com>
- Saturday, May 25, 2002 at 10:30 AM (CDT)
Thank you to the Goodwin's for thinking of us here, and remembering the little boy -- Jackson Ben.
Many blessings to you all -
Love The Espeseth Family
M.Espeseth <eaglet@cltcomm.net>
Clear Lake, Wi - Sunday, May 19, 2002 at 07:55 AM (CDT)
Hi guys
Congratulations on raising so much for the Relay
you guys did an awesome job!
Chris
Gooch’s Page
<chrisrusso_@hotmail.com>
- Saturday, May 18, 2002 at 11:04 PM (CDT)
I'll be thinking of you guys as you do your relay for life tonite! You should be pretty darn proud of all your efforts! GOOD LUCK! I'm sure emotions will be runnig high, especially as they read off the names of all the survivors and announce Aidan Goodwin amongst them! God Bless you all.
Kellie
Kellie Nelson <sonofanelson@aol.com>
- Friday, May 17, 2002 at 03:33 PM (CDT)
Good morning,
We sure hope the weather is good for the Relay tonight. It was good to hear that Aidan can participate too. Nice to read that he is doing good. Andrew sounds like he has been having lots of fun keeping busy with ball and friends.That is awesome that your team raised so much money for such a wonderful cause. Elizabeth- you are a true inspiration and wonderful person and mother.Enjoy the Relay and we will be thinking of you and all the families that are involved.
Take care.
Heather
Heather Anderson <tandha@amerytel.net>
- Friday, May 17, 2002 at 09:50 AM (CDT)
Happy Mothers Day dear Elizabeth! I hope your sweet boys were showering you with extra hugs, kisses, and I love you's today!
God Bless, Kellie
Kellie Nelson <sonofanelson@aol.com>
- Sunday, May 12, 2002 at 07:11 PM (CDT)
I just stopped by to say "Hello". I hope that you are all enjoying the Spring. Enjoy the Mother's Day weekend.
Happy Mother's Day Elizabeth :)
Heather Anderson & Family <tandha@amerytel.net>
Clayton, WI - Thursday, May 09, 2002 at 09:53 PM (CDT)
Hello Goodwin's
I hope you guys are enjoying the weekend
(we are getting very rained out here)
and I hope all is well there!!!
Chris <chrisrusso_@hotmail.com>
www.caringbridge.com/page/gooch
- Sunday, April 28, 2002 at 02:37 PM (CDT)
You have two very beutiful children. I hope that everything goes good with Aidan's test today. I cam upon your website when I was looking for some info. My son Tommy, was dx with ALL 6-21-01. He is doing o.k. I hope and Pray that everything will be better for you all real soon.
Hugs and PRayers,
Dawn Gresham - Tommy's Mom ALL-Kids <bdmtg@hotmail.com www.caringbridge.com/sc/tommygresham>
Warrenville, SC - Friday, April 26, 2002 at 09:41 AM (CDT)
Hope all goes well with counts and the gamma globulin on Friday...bring lots of movies, that'll be a long day! Hopefully this will be Aidan's ticket to feeling better and staying "healthy"!
Always in my prayers...
Kellie
Kellie Nelson <sonofanelson@aol.com>
Big Lake, Mn - Wednesday, April 24, 2002 at 10:23 PM (CDT)
Praying for the "fever bugs" to stay away. :)
Many blessings to you all today....and always.
The Espeseth family <eaglet@cltcomm.net>
Clear Lake, Wi - Saturday, April 20, 2002 at 11:55 AM (CDT)
Hope Aidan is feeling better soon. Keep us posted.
Way to go Andrew.
Dad
Dave Munro <munros@pacifier.com>
- Thursday, April 18, 2002 at 06:17 PM (CDT)
Hello Goodwin Family,
It sounds like things are going good and the boys are having lots of fun enjoying the weather.The weather is finally nice here too.It is such a busy time of year. We hope that you have a good week. Take care.
Heather & family <tandha@amerytel.net>
Clayton, WI - Monday, April 15, 2002 at 09:34 PM (CDT)
Hey i am Praying for you and your family i hope all goes well and you are always in my heart
tasha <tasha_dolphins@yahoo.com>
- Monday, April 15, 2002 at 02:28 PM (CDT)
Uncle Ralph and Aunt Karen send their love. Have a good week.
Ralph and Karen Munro <ralphmunro@attbi.com>
Olympia, Wash USA - Sunday, April 14, 2002 at 09:07 PM (CDT)
Ralph and Karen Munro ralphmunro@attbi.com
Ralph and Karen Munro <ralphmunro@attbi.com>
Olympia, , Wash United States - Sunday, April 14, 2002 at 09:05 PM (CDT)
HELLO TO AIDAN AND FAMILY!!!
I JUST RECEIVED AN EMAIL REQUEST FROM KIRSTEN TO SPONSOR HER FOR THE CHARITY WALK...I WOULD BE HONORED. HOW DO WE GO ABOUT GETTING THE MONEY TO YOU OR HER OR...? I WANT YOU ALL TO KNOW THAT I HAVE BEEN PRAYING FOR ALL OF YOU EVER SINCE KIRSTEN FIRST TOLD US ABOUT AIDAN AT A MOM'S MORNING MEETING...GOD'S BLESSINGS TO ALL OF YOU FOR STRENGTH, HEALING AND MUCH JOY!
MY THOUGHTS AND PRAYERS ARE WITH YOU....HEIDI
HEIDI TITTLE <heidihoneighborette@msn.com>
richland, wa USA - Friday, April 12, 2002 at 04:37 PM (CDT)
Elizabeth,
Kirsten asked me to sponsor her in the Relay for Life and linked me to this webpage. You guys are so awesome and strong! And hurray for all that you are doing for charity!!! God bless you, and your family remains in our prayers! See you at Bunco!
Lisa Corning <corningclanfive@msn.com>
- Friday, April 12, 2002 at 03:32 PM (CDT)
I'm sorry I am such a nincompoop
Happy Birthday Andrew
I cant believe you are going to be 6 already, Ron's just 5 and I thought HE was a big boy!
I hope you have a lot of fun tomorrow with your family buddy!!
Chris <chrisursso_@hotmail.com>
- Saturday, April 06, 2002 at 11:23 AM (CST)
Happy Birthday Wishes to Andrew !
xoxoxox The Espeseth family <eaglet@cltcomm.net>
Clear Lake, Wi - Friday, April 05, 2002 at 08:44 PM (CST)
Adian and family....
My son was dx'd with ALL about a week after you (9/6/00). He will be 7 very close to when Andrew will be turning 6.
Kind of a strange coincidence....Glad that you are feeling good today. I pray for more of those days for you.
Wesley's Mom--caringbridge.com/mn/wesleypeterson <deansducks@juno.com>
Newport, MN - Tuesday, April 02, 2002 at 08:21 AM (CST)
Happy Easter Mike,Elizabeth,Andrew and Aidan
We wish you a beautiful Easter. We hope that you have a wonderful and happy day.
Heather,Tom, Jordan, Carter, Karissa & Trey Anderson <tandha@amerytel.net>
Clayton, WI - Sunday, March 31, 2002 at 11:26 AM (CST)
Hey Aidan and family,
just wanted to wish you guys a happy & healthy Easter.
Chris
www.caringbridge.com/page/gooch
<chrisrusso_@hotmail.com>
- Saturday, March 30, 2002 at 03:00 AM (CST)
Hey Elizabeth and family,
Just "hopped" by (a little early) to wish you all a happy Easter! Since Aidan will be welcoming the Easter holiday on steroids I hope the bunny throws a few extra pieces of chocolate, or pepperoni pizza's in his basket this year. Hopefully you'll all have a nice, quiet uneventful five days!
God Bless!
Kellie
kellie nelson <sonofanelson@aol.com>
- Thursday, March 28, 2002 at 10:28 PM (CST)
Greetings from Camas! Love the new pictures of the kids - we can't believe how much they've grown. Please know your all in our thought's and prayers.
"...for this day is holy to our Lord; and do not be grieved for the joy of the Lord is your strength." Nehemiah 8:10
Much love, Sean and Tamara Malone
Tamara Malone <tamaramalone@hotmail.com>
- Friday, March 22, 2002 at 10:56 AM (CST)
Hello Goodwin Family
We are happy to hear that everything is going well there. It is great to hear that the fundraiser was a huge success. Do you have a address in which people can send donations? I would love to support such a wonderful cause. The pictures of Andrew and Aidan are so precious. Andrew looks like he is such a good big brother. They are both adorable. Hope that you have a beautiful weekend and that you don't get too much more snow so your next weeks Dr. visits are a safe drive. Our thoughts are with you all. Especially with Brave Big Brother Andrew. He is a special little man too.
Heather and family <tandha@amerytel.net>
Clayton, WI - Thursday, March 21, 2002 at 11:02 PM (CST)
Hi, I don't know you an dyou don't know me.
But I'm sorry to hear about Aiden.
Tell him to get better soon!
Becca <beccayellow_05@msn.com>
Wtn., SD USA - Wednesday, March 20, 2002 at 05:49 PM (CST)
Hey Aidan and family,
Glad to hear nothing but good news here
Low counts aside, because they are to be expected.
You two are so cute!
Mom/Dad, drop by if you are interested in pix on front page of the sites.
Chris
www.caringbridge.com/page/gooch
<chrisrusso_@hotmail.com>
Bethel, CT - Friday, March 15, 2002 at 11:52 PM (CST)
I'm glad to hear Aidan's feeling better again, and I love the new pictures of my boys! :)
miss you all tons!
Paula
Paula <paulajwilson@cs.com>
- Friday, March 15, 2002 at 07:20 PM (CST)
Great pictures. Are these with your digital camera?
More details on Andrews school report please.
How many potatoes in the stew?
Dad
Dave Munro <munros@pacifier.com>
- Friday, March 15, 2002 at 09:29 AM (CST)
Just stopped to see how everything is going and wish you all well. I don't know about you Washingtonians, but we'll probably see a few more heavy snow falls before spring is finally sprung around here.
Hang in there everybody!!!
Kellie
Kellie Nelson
Big Lake , MN - Monday, March 11, 2002 at 10:29 AM (CST)
Just stopped to say "Hello". We sure hope that the Goodwin Family is feeling better. Spring is almost here. Take care.
Love, Heather and Family
- Thursday, March 07, 2002 at 09:44 AM (CST)
Sounds like it's been a pretty long and miserable winter for you guys too in terms of colds and illness. Hopefully March will bring with it beautiful weather and good healthy children!!! Hang in there----this too shall pass!
Take Care you guys
Kellie
Kellie Nelson <sonofanelson@aol.com>
Big Lake, MN - Friday, March 01, 2002 at 09:54 PM (CST)
Good trip home. Stopped at Carson Hot Springs for lunch. Now there is a possible SPA for you and mom to think about!!! Hope boys are feeling better. I think your photo album in this program needs an update. We had a great time in Richland, but slept well last night.
Love. Dad
- Tuesday, February 26, 2002 at 11:53 AM (CST)
Hey Aidan & Family
glad to hear you are on the road to 100%
it just takes a little longer in you guys on the chemo
Ron battled the cough for quite a while afterwards....
Chris
www.caringbridge.com/page/gooch
<chrisrusso_@hotmail.com>
Bethel, CT - Saturday February 23, 2002 7:52 PM CST
Elizabeth---thank you so much for your last email. It was good to hear from you, as your words of encouragement mean a lot to us. It is good to feel the love and concern from those whom we have never even met. I am sure that you also see through Aidan how many lives are being touched, and how many people truly care out there in the world. I know that Aidan has been in our thoughts and prayers. It is good to hear that he is marching right along through all of the little "fever bugs". He sounds very healthy and strong. :) What a wonderful day that will be when these treatments are behind him and he can look back and tell everyone of the battles that he fought and won ! Jackson had a little race car with Joshua 1:9 on it, as you have on the web page. Hold to that verse and that promise. Many blessings to you all.
Jackson's mom, Michelle <www.caringbridge.com/wi/jacksons.journey>
Clear Lake, WI USA - Tuesday February 19, 2002 9:10 AM CST
Hello... I was just checking in to see how you are all doing. We hope that all is better.
- Monday February 18, 2002 10:51 PM CST
Hi Aidan,
You are one goodlooking guy. I am glad you are feeling better. Stay strong! We are praying for you & your family.
Tutee <http://www.caringbridge.com/ga/chasesmiracle/ chasesmiracle@yahoo.com>
Georgia USA - Saturday February 16, 2002 10:33 PM CST
Hello Elizabeth and family---Happy Valentines day!!!
I just wanted to let you know I stopped by for a "visit", read all your journal entries and checked out the photo album. I'm so glad I "found" you guys and am looking forward to "talking" with you soon. I'm sure we could exchange stories forever!!! Like you, we've stumbled across ALOT of road blocks in this crazy and unanticipated journey, but as we approach our one year anniversary into Maintenance---all is well!
Take Care all---hope Aiden pulls through this, whatever it is he's dealing with, (don't you just hate this time of year)---he will---we've been blessed with amazingly strong children! Hang in there and keep your chins up---
Kellie
Kellie Nelson <sonofanelson@aol.com>
Big Lake, MN - Thursday February 14, 2002 8:30 PM CST
Happy Valentine's Day Wishes
Mike, Elizabeth,Andrew & Aidan
We are happy to hear that Aidan is home from the hospital and that the tests came back negative. I am sure that your whole family is happy to be together again at home. Ecspecially for Valentines Day. I bet Andrew is enjoying all his little Valentines from his friends and of course the fun party at school. Enjoy the day with you all being at home together. Take care family..We will continue to pray for your family.
Love From,
The Anderson's Tom ,Heather,Jordan,Carter,Karissa & Trey
Clayton, WI - Thursday February 14, 2002 1:34 PM CST
Happy Valentines day!!!
Thanks for sharing this with the world.Today my freind found out her daughter of seven years old have leukemia.She is already amitted to the hospital.I know she will have a long road ahead of her. But with stories like yours it make it so much easier to deal with this. Thanks for sharing glad you are doing good. Will be praying for you. God bless you
Dorothy Budden <budden@superweb.ca>
Newfoundland, Ca - Thursday February 14, 2002 11:05 AM CST
HAPPY VALENTINE'S DAY !!!!
![](http://www.geocities.com/goochsplace/heart-2.gif")
Chris {Goochie's mom}
www.geocities.com/goochsplace
<chrisrusso_@hotmail.com>
- Wednesday February 13, 2002 11:18 PM CST
Thank you so much for keeping us informed. Sharon and I will pray for Aidan and for you and Mike, Elizabeth.
Uncle Doug <nyhus@inforum.umd.edu>
Silver Spring, Md USA - Tuesday February 12, 2002 2:41 PM CST
We are sorry to hear that Aidan is in the hospital. Winter makes everything so much more harder. We are praying for Aidan's pnemonia will go away and he will be back on the right path again. We will continue to keep you all in our thoughts and prayers.
Heather & family <tandha@amerytel.net>
- Monday February 11, 2002 10:28 PM CST
Hello Aidan!
We sure hope that your fever goes away soon and that your counts improve too. So that you can see your little friends soon and get back to being able to do things outside the house again.
Enjoy the rest of the weekend and get better soon little guy. Give your Mommy a little hug.
Heather and Family <tandha@amerytel.net>
- Saturday February 9, 2002 6:34 PM CST
Hello Aidan!
I missed the teleconference.
Yes, its pretty scary isnt it.. will we ever fully sigh with relief and not fear again?
I am sorry to hear his counts are so low..
we are still dealing with this darn cough - we'll see pulmonologist this week if not cleared up yet.
Love those steroid weeks, dontcha??!!!!
Chris
www.geocities.com/goochsplace
<Chrisrusso_@hotmail.com>
Bethel, CT - Friday February 1, 2002 12:39 AM CST
Hang in there Aidan. Give us a call and tell us what you are doing. We would love to talk to you.
Grandma and Grandpa
- Friday February 1, 2002 11:39 AM CST
Checking in. Guess mom just got all the news from you on the phone. Love to all.
Dad
- Saturday January 26, 2002 10:44 PM CST
Hey Liz and Mike - our thoughts and prayers are with you...Matt and I just added boy number two to our family, James Henry McDonagh was born on Oct. 12, 2001. Someday, we'll all waterski together.....
Laura McDonagh <mcdonaghmatt_laura@hotmail.com>
Boise, ID - Friday January 25, 2002 4:27 PM CST
We are happy to hear Aidan is home again.We hope that he gets better soon. We will continue to keep you in our prayers. Take care.
Heather&Tom Anderson and family
Wi - Sunday January 20, 2002 9:07 PM CST
Hang in there, you guys! Glad to hear the big A may be going home soon. We love you! A big hug for cousin Andrew, too!
Michael, Nikki and Steve
<cycle4two@msn.com>
Vancouver, WA USA - Saturday January 19, 2002 3:10 PM CST
You are all continually in our thoughts and prayers. We are really proud of your whole family. Let us know where and when we can help. Love.
Dad
- Saturday January 19, 2002 3:07 PM CST
UGH. We just got over (well, almost over) a bout with pneumonia ourselves. Hope all goes well & no fevers & no cultures grow!
Chris
www.caringbridge.com/page/gooch
<Chrisrusso_@hotmail.com>
Bethel, CT - Friday January 18, 2002 9:19 PM CST
I have just read your letter, Elizabeth, and have put Aidan on the church prayer chain. My thoughts and prayers are with you, and hope for a quick, uneventful recovery. Peace, Elizabeth-you have a strong loving support group sustaining you. Love, Fran
Fran Myers <fmyers@3-cities.com>
Kennewick, WA - Friday January 18, 2002 8:46 AM CST
Thanks for the update. Take good care of Aidan. We will see Mike on the slopes next year.
Steve Phouse
- Thursday January 17, 2002 3:48 PM CST
I am a teacher in Aurora, Il. My biology students may be reading your child's story in the next week or two. Thanks for sharing. This makes learning about different kinds of cancers very relevant to teens.
Mrs. Anderson
-
Glad everything went well in Redmond. We were anxious to hear the results and pleased with the good news. Mom and I saw "A Beautiful Mind" tonight. Think you would enjoy it. Love. Dad
Dave Munro
- Friday, January 04, 2002 at 11:48 PM (CST)
It was great seeing you at Christmas! We look forward to seeing you all again soon. Mike, Katherine says "Mike!"
Scott <smunro@egreen.wednet.edu>
- Saturday, December 29, 2001 at 02:57 PM (CST)
Looking forward to your visit. Hope Santa shows up!!
Mom and Dad
- Friday, December 21, 2001 at 12:17 AM (CST)
Hello.. I stumbled upon your page in the ACOR site.
My son Ronnie will be 5 in January - he was diagnosed with ALL in July 2000. (And he was Spiderman for Halloween- you guys would've made quite a team - and his dog was dressed like Superman!) I hope you all have a healthy and happy holiday and upcoming year and pray for permanent remissions for all you kids!
Chris www.caringbridge.com/page/gooch
<chrisrusso_@hotmail.com
>
Bethel, CT - Saturday, December 08, 2001 at 01:46 PM (CST)
Maybe the Nutcracker will encourage a career as a ballet dancer or ice skater? Just kidding Mike. Happy birthday Aidan. Andrew, I am sure you will make a great Joseph.
Grandpa
- Friday, December 07, 2001 at 07:24 PM (CST)
Happy 3rd Birthday to Aidan ! We wish you a very special day :)
Thinking of you all...hope that the treatment goes well today and that his cold is better. God bless you.
The family of Jackson Espeseth
Clear Lake, Wi - Friday, December 07, 2001 at 09:52 AM (CST)
Hi, I am a friend of the Jackson Espeseth's family, I am so sorry to hear what Aidan is going through. May God bless your wonderful little boy and keep him safe. Believe in miracles and never give up, Jackson witnessed many many miracles in his short time here on Earth. (What a wonderful journey he brought us on) :) I will keep you all in my prayers, take care and God bless and heal your little guy.
My love to you,
Jody
Jody Olsen <jods68@yahoo.com>
New Richmond, WI - Thursday, December 06, 2001 at 06:44 PM (CST)
Happy Birthday wishes to Aidan!! We hope that you are feeling better. Enjoy your birthday party with your little friends. Take care.
Tom and Heather Anderson and family
Clayton, WI - Friday, November 30, 2001 at 08:55 AM (CST)
May the Lord continue to richly bless you.
Our prayers are with you
http://www.cyberport.com/~beanie
Nikki McHattie <godsproperty777@yahoo.com>
Baden, PA 15005 - Wednesday, November 28, 2001 at 06:05 PM (CST)
May God bless you and continue to give you and your family strength!!
Mikeani Gardner <mikeanitiyona@yahoo.com>
statesboro, GA USA - Monday, November 26, 2001 at 04:19 PM (CST)
Wishing you a wonderful Thanksgiving Day ! Many blessings to you all.
The Espeseth family
Clear Lake, WI - Thursday, November 22, 2001 at 09:36 AM (CST)
I just wanted to let you know that we think of you all a lot. I continue to check in weekly on Aidan's progress. I hope that he is doing well. We continue to pray for Aidan and his whole family. Take care.
Heather & family
Wi - Tuesday, November 13, 2001 at 02:22 PM (CST)
Thanks for the update. We are going to Bainbridge tomorrow for three days and then Bill and Judy will be here next weekend for the Huskies/Oregon State game in Corvallis. Looks like the Apple Cup could be a big game this year. Grandma has been here all weekend and we are enjoying her visit while Clarice is in Corvallis with Sara. See you on Thanksgiving.
Dad
- Monday, November 05, 2001 at 10:19 AM (CST)
Wishing you a safe and Happy Halloween. The boys will be so cute in their Superman and Firefighter outfits. Hope that Aidan is doing well.
Heather & family
- Wednesday, October 31, 2001 at 09:30 AM (CST)
It was nice talking to the boys today (you also). We are looking forward to your Thanksgiving stay..
Mom and Dad
Dave Munro <munros@pacifier.com>
- Tuesday, October 30, 2001 at 08:20 PM (CST)
With thoughts and prayers.
- Monday, October 22, 2001 at 09:21 PM (CDT)
I just wanted to say Hello and that I am thinking about you all. I hope all is well.We hope that all the tests continue to go well. Take care.
Heather & family
- Wednesday, October 10, 2001 at 03:04 PM (CDT)
We had a great time this week with all of you. What a difference every month makes in seeing Aidan and
Andrew grow and mature. You are great parents.
Dave and Sue Munro
- Friday, October 05, 2001 at 11:35 PM (CDT)
What a GREAT web page you have created!! My compliments. and what a super way to keep up with the rest of us. I can't believe so much time elapsed before I asked about Aiden. I think the summer flew by on wings. We will be praying you all through this current treatment.
Judy Smedley <rjsmedley2@home.com>
Lakewood, WA Pierce - Friday, October 05, 2001 at 06:45 PM (CDT)
Thank you for your words of encouragement that you sent to us. Our thoughts and prayers are with you....many blessings to you all. Special prayers for Aidan...so glad to hear that he is doing well !
The family of Jackson Espeseth
Clear Lake, WI - Thursday, October 04, 2001 at 05:28 PM (CDT)
WAY TO GO AIDAN.
WE LOVE YOU ALL : G & G
DAVE AND SUE MUNRO <munros@pacifier.com>
- Saturday, September 29, 2001 at 10:46 AM (CDT)
Good to hear that the steriods are not affecting him as they have in the past. Lots of good news! Continued prayers and warm thoughts. So good to see you guys. Lots of love.
Brenda, Marty and Tanner Snell <bksnell@pacifier.com>
Camas, WA Clark - Tuesday, September 25, 2001 at 12:06 AM (CDT)
We are happy that everything is going good with Aidan and your whole family. It sounds like he is enjoying his little friends. Have a beautiful weekend. Enjoy your time together.
Heather, Tom , Jordan,Carter,Karissa & Trey Anderson <tandha@amerytel.net>
Clayton, WI - Thursday, September 20, 2001 at 09:18 PM (CDT)
Keep this going. We enjoy seeing it in writing as well as hearing from you steadily. Any new pictures?
Mom and Dad
Dave and Sue Munro <munros@pacifier.com>
Vancouver, WA USA - Tuesday, September 11, 2001 at 07:06 PM (CDT)
Daivd Christy
I forgot to tell you that my brother, and my mom and dad as wish you well get better and make a full recovery.
love kc, don3, don and diane
kc jo heggemeier <kheggr@yahoo.com>
farmington, mn usa - Sunday, September 09, 2001 at 07:44 PM (CDT)
Thinking of you all and hope that Aidan is doing well. How does Aidan like preschool?? Have a wonderful weekend.
Heather
- Thursday, September 06, 2001 at 08:59 PM (CDT)
Aidan and family -- what a year its been for you. A journey you didn't plan ... and look how far you've come! Remember than when you are too weary to continue, Christ himself will carry you! Blessings to you all and we'll continue to pray for your complete recovery for stamina for you and your family to endure the healing road.
Brian, Chris & Brock Bowers <bowersemail@home.com>
Auburn, WA USA - Monday, September 03, 2001 at 02:00 AM (CDT)
Hello. We wish you a wonderful week. We hope that all is well with Aidan. How exciting that he is going to be starting preschool. Aidan will have so much fun. Take care.
Heather and family
Clayton, WI - Monday, August 27, 2001 at 03:29 PM (CDT)
We also had a great time at the beach. What fun to watch those two boys play in the sand. See you next week.
Dad
- Tuesday, August 21, 2001 at 11:44 PM (CDT)
It sounds like you had a great funfilled trip. I wish you a wonderful day.
Heather and family
- Monday, August 20, 2001 at 12:37 PM (CDT)
I liked your picture of you on the lion. I also had fun playing with you at your house last night. I'll see you at the park tomorrow!
Your friend, Brayden
Brayden Vickerman <kirstvick@hotmail.com>
Kennewick, wa - Sunday, August 19, 2001 at 09:13 PM (CDT)
Dear Aidan,
Aunty Nan asked me to find out how you are. She loves you very much and hopes that you are having a good summer.I keep you in my prayers for a great summer and good health.
Peg Hall <melpeghall@cs.com>
Kennewick, Wa. USA - Thursday, August 16, 2001 at 12:42 PM (CDT)
Thinking of you and hoping that Aidan is doing great. Wishing you a wonderful week. You are in our thoughts and prayers.
- Tuesday, August 14, 2001 at 10:37 PM (CDT)
We wish you a wonderful vacation.We were happy to hear that Aidan's counts were good. It is so nice to hear good news.The new photos are very precious. The boys look so cute. You and your family are in our prayers. Have a great week. Take care.
Heather & family <tandha@amerytel.net>
- Tuesday, August 07, 2001 at 09:29 PM (CDT)
Thank you for your words of encouragement for our family. It was so good to hear from you. We surely appreciate your kindness. We will keep you and your beautiful little boy in our thoughts and prayers. Thank you for sharing your journey with us all. May the Lord give you the strength to press on through these days during recovery...and give you that special peace in your heart as only He can give. Many blessings to you all....wishing you sunshine and smiles in all the days to come. :)
The family of Jackson Espeseth
Clear Lake, WI - Wednesday, August 01, 2001 at 12:27 PM (CDT)
May God Bless Aidan and his precious family. It will be a long hard bumpy battle to recovery. We wish you all the best. Cancer is such a hard thing on precious little children. We just lost our beautiful little nephew Jackson to luekemia in May. The medical fields have come a long way and we wish Aidan a successful recovery.You will be in our thoughts and prayers. May God Bless you always.
Heather and Tom Anderson <tandha@amerytel.net>
Clayton, WI USA - Friday, July 27, 2001 at 02:26 PM (CDT)
Hi Goodwins! What a darling picture of Aidan in the Oregon Zoo hat. We're thinking of you all.
The Pollocks <bpbmspollock@kalama.com>
Kalama, WA - Thursday, July 26, 2001 at 10:27 AM (CDT)
HI Aidan. My name is Jen Noe. I am 13 and love to read and talk to people. I would love to hear from u!!! Love in Christ Always, Jen Noe:)
Jen Noe <jen.vms@edmail.com>
Marion, IA USA - Monday, July 23, 2001 at 02:14 PM (CDT)
We think of you often
Keith and Melinda Johnston <keithandmelindaj@aol.com>
Gilbert, AZ - Thursday, July 19, 2001 at 12:51 PM (CDT)
We have the web-page bookmarked and we check in frequently. Your all in our thought's and prayers. God Bless.
Sean & Tamara Malone <tamaramalone@hotmail.com>
Camas, WA USA - Wednesday, July 18, 2001 at 03:09 PM (CDT)
Thinking of you - and a big hug for Aiden
The Law's <mrlandscape@worldnet.att.net>
Tigard, OR USA - Tuesday, July 17, 2001 at 10:50 PM (CDT)
Dave and Sue Munro <munros@pacifier.com>
Vancouver, WA Clark - Tuesday, July 17, 2001 at 12:59 AM (CDT)
Good morning. It seems I logged on just as you completed you last update!! Wonderful to learn the boys are enjoying the summer amidst the challenges of treatment. We'll see you on your next visit west. keep well
maureen horgan <horgan.m@ghc.org>
redmond, wa - Wednesday, June 20, 2001 at 11:04 AM (CDT)
What darling pictures of the boys, and how lucky I am that I get to see them in person often! Fran
Fran Myers <fmyers@3-cities.com>
Kennewick, Wa Benton - Monday, June 11, 2001 at 04:55 PM (CDT)
Thank you for keeping us updated. Sharon and I remember you in our prayers. We know all too well the tension that those "counts" can bring on. We rejoice of the progress you all have made.
Love,Doug & Sharon
Doug Nyhus <nyhus@inforum.umd.edu>
Silver Spring, Md USA - Monday, June 11, 2001 at 07:50 AM (CDT)
What a great way to keep everyone updated on Aidan's progress ... great idea!!
Annamaria Praga <dpraga@nwinfo.net>
Richland, WA USA - Tuesday, May 15, 2001 at 05:02 PM (CDT)
Glad to hear things are "turning the corner" for you all. Best wishes, Scott
Scott Caldwell <pscaldwell@longfibre.com>
- Tuesday, May 15, 2001 at 11:28 AM (CDT)
I'm book-marking this, of course. It was so great to see you all this weekend. :)
love you!
Paula <paulajwilson@cs.com>
Seattle, WA - Sunday, May 13, 2001 at 09:03 PM (CDT)
Hello to the "webmaster" Goodwins! What a great webpage! It will be a great way to use the digital camera when you get it; which one did you order?
See you all this weekend!
Scott
Scott Munro <smunro@egreen.wednet.edu>
Vancouver, WA USA - Friday, May 11, 2001 at 10:36 AM (CDT)
It has been wonderful reading your e-mails about Aidan. I feel even though we haven't had a chance to talk much, I know all that's going on with the Goodwins.
Jennifer Gwin <jenrog@kalama.com>
Kelso, WA USA - Friday, May 11, 2001 at 12:36 AM (CDT)
This is a great way to keep everyone updated. See you all tomorrow evening, in Vancouver, "where the sun always shines."
Dave and Sue Munro <munros@pacifier.com>
Vancouver, WA Clark - Thursday, May 10, 2001 at 06:46 PM (CDT)
Click here to sign the guestbook.
Click here to return to the current guestbook.
Click here to go back to the main page.